TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|29165348|gb|AAO65268.1| iodothyronine deiodinase type I Deio1 [Danio rerio] (241 letters) Database: L.tarentolae/genome.fa 7267 sequences; 31,598,840 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Lt_contig583 | | 1 to 15375 28 7.1 Lt_contig5308 | | 1 to 2106 27 9.3 >Lt_contig583 | | 1 to 15375 Length = 15375 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +1 Query: 121 RPLVLSFGSCTUPPFLYKL 139 RPL+L F SC PPFLY L Sbjct: 4810 RPLLLPF-SCLAPPFLYSL 4863 >Lt_contig5308 | | 1 to 2106 Length = 2106 Score = 27.3 bits (59), Expect = 9.3 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 4/72 (5%) Frame = -1 Query: 23 CAAILQMSMLKLLSFISPGRMRKIHMK--MGERSTMTQNPKFRYE-DWGPAFFSLAFIKT 79 C AIL S LL+ SP + H+K + +RS TQ + WG ++ + Sbjct: 1962 CTAILSYSSSHLLAHASPNILLSGHVKSSLEKRSAHTQRVRRSPNLVWGST*YTFIHTER 1783 Query: 80 L-FFVNWCSLGL 90 L F W S GL Sbjct: 1782 LRVFAEWRSCGL 1747 Database: L.tarentolae/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,598,840 Number of sequences in database: 7267 Lambda K H 0.324 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 9,398,793 Number of Sequences: 7267 Number of extensions: 126488 Number of successful extensions: 616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 20 Number of HSP's that attempted gapping in prelim test: 166 Number of HSP's gapped (non-prelim): 476 length of query: 241 length of database: 10,532,946 effective HSP length: 97 effective length of query: 144 effective length of database: 9,828,047 effective search space: 1415238768 effective search space used: 1415238768 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 59 (27.3 bits)