TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|29165348|gb|AAO65268.1| iodothyronine deiodinase type I Deio1 [Danio rerio] (241 letters) Database: D.fasciculatum/genome.fa 25 sequences; 31,019,208 total letters Searching.........................done Score E Sequences producing significant alignments: (bits) Value gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced ... 30 1.2 gi|328871053|gb|GL883014.1| Dictyostelium fasciculatum unplaced ... 28 7.5 gi|328869574|gb|GL883020.1| Dictyostelium fasciculatum unplaced ... 27 9.8 >gi|328864870|gb|GL883029.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EUAJFUG02HR96I-5, whole genome shotgun sequence Length = 3408800 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 6/57 (10%) Frame = -2 Query: 63 RYEDWGPAFFSLAFIKTL------FFVNWCSLGLEAFEGHAAPDSALITLDRQKTSV 113 + ++ P F++++FI L FFVN C L ++ S +IT R+KT + Sbjct: 2394739 KVKEIAPKFYTISFIVLLATASLTFFVNGCILVVQMKRHDQKTQSTIITATRKKTKI 2394569 Score = 28.1 bits (61), Expect = 5.7 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 15 YISAVLMVCAAILQMSMLKLLSFISPGRMRKIHMKMGER-STMTQNPKFRYEDW 67 YIS L+ +A+L ++L +S G+ K+H+K S N + +DW Sbjct: 163058 YISLHLISFSALLNSTLLI*ISVCEMGKSNKLHLKFNVTISAQFGNSPIKEDDW 163219 >gi|328871053|gb|GL883014.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_Dfasci-F-a-11f03.f1-5, whole genome shotgun sequence Length = 911335 Score = 27.7 bits (60), Expect = 7.5 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -1 Query: 101 SALITLDRQKTSVHRFLKGNRPLVLSFGSCTU-PPFLYKLDEFKQLVKDFSNVADFLIVY 159 SA T++R K +F++ NR +LS C L+KL F K+ S + Sbjct: 552007 SAAKTIERYKADTLQFVQSNR--LLSIFDCEFLTADLFKL-HFDTYCKETSILEVIEAFS 551837 Query: 160 LAEAHATDAWAFKNNVDI 177 H+ D W F+ +DI Sbjct: 551836 HNNRHSRDTWLFRRVIDI 551783 >gi|328869574|gb|GL883020.1| Dictyostelium fasciculatum unplaced genomic scaffold Scf_EJPB12P01AWP9W-5, whole genome shotgun sequence Length = 629417 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 102 ALITLDRQKTSVHRFLKGNRPLVLSFGSC 130 + ++ DRQ T + FLK NR +V+++ C Sbjct: 123556 SFLSFDRQNTYIICFLKSNRCVVMTWSIC 123470 Database: D.fasciculatum/genome.fa Posted date: Nov 21, 2011 7:46 PM Number of letters in database: 31,019,208 Number of sequences in database: 25 Lambda K H 0.324 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,776,531 Number of Sequences: 25 Number of extensions: 102305 Number of successful extensions: 619 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 588 Number of HSP's gapped (non-prelim): 83 length of query: 241 length of database: 10,339,736 effective HSP length: 97 effective length of query: 144 effective length of database: 10,337,311 effective search space: 1488572784 effective search space used: 1488572784 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 59 (27.3 bits)