TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= (189 letters) Database: genome.fa 9 sequences; 8,347,606 total letters Searching.........done Score E Sequences producing significant alignments: (bits) Value gb|AAGK01000005.1| Theileria parva strain Muguga chromosome 3 ct... 32 0.10 gb|AAGK01000001.1| Theileria parva strain Muguga chromosome 1 ch... 28 0.85 gb|AAGK01000004.1| Theileria parva strain Muguga chromosome 4 ct... 27 2.5 gb|AAGK01000002.1| Theileria parva strain Muguga chromosome 2 ch... 26 4.2 >gb|AAGK01000005.1| Theileria parva strain Muguga chromosome 3 ctg_530, whole genome shotgun sequence Length = 1317241 Score = 31.6 bits (70), Expect = 0.10 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = +1 Query: 66 AAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEG 125 A EPD + + + A ++ E+NA++ + +EKL L+EEKR + + + Sbjct: 185128 AFTITEPDPLEREKRAKL---VQQYNEMNAEISEIQEKLTNLQEEKRELFDYLHNKYKNS 185298 Query: 126 KSY 128 K Y Sbjct: 185299 KDY 185307 Score = 25.0 bits (53), Expect = 9.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 39 FSCILLYVVFQKLSARLRALRQRQLD 64 F C+ L V+FQ+ R LRQ ++D Sbjct: 260395 FLCVFLQVIFQRFKK**RPLRQIKVD 260472 >gb|AAGK01000001.1| Theileria parva strain Muguga chromosome 1 chr1_complete, whole genome shotgun sequence Length = 2540030 Score = 28.5 bits (62), Expect = 0.85 Identities = 16/70 (22%), Positives = 36/70 (51%) Frame = -1 Query: 87 LKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSPGPSTS 146 +K E+ + ++H+E+ ++EEE+++Q+++ K N +K ++E Sbjct: 466349 MKRTSEIYQRRQEHQEEQMRVEEERKKQELQQ----------KINEEKAEKERREEALRQ 466200 Query: 147 SVLKRKSDRK 156 L+RK D + Sbjct: 466199 LELQRKKDER 466170 Score = 27.3 bits (59), Expect = 1.9 Identities = 17/65 (26%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +1 Query: 78 RQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMW-DSMQEGKSYKGNAKKPQ 136 R++ L + K+ E+L+ Q+E +EKL + + K K+ ++ +S+++ ++ K +K Q Sbjct: 245041 RKKVLEPDKQKL-EQLSKQIESFEEKLNEWKSAKESYKLALYRESVEDYETAKTKYEK-Q 245214 Query: 137 EEDSP 141 + ++P Sbjct: 245215 KHNNP 245229 Score = 27.3 bits (59), Expect = 1.9 Identities = 17/83 (20%), Positives = 47/83 (56%), Gaps = 7/83 (8%) Frame = -2 Query: 59 RQRQLDRAAAAVEPDVV--VKRQEALAAARL-----KMQEELNAQVEKHKEKLKQLEEEK 111 ++++ ++A A E +++ +K+QE + AR+ K + E+ AQ ++ +++ + +++ Sbjct: 1201333 KEKEAEKARQAKETELLATIKQQETESLARIAEEKQKREAEILAQEQQLQQRRQAHDDQI 1201154 Query: 112 RRQKIEMWDSMQEGKSYKGNAKK 134 RR + E+ + + K A++ Sbjct: 1201153 RRSQEELDRKIADDKQKSAEAEE 1201085 Score = 25.4 bits (54), Expect = 7.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 133 KKPQEEDSPGPSTSSVLKRKSDRKPLRG 160 K+P+++DS GP T K + K +G Sbjct: 773653 KEPEDKDSKGPETPQPQPEKPEDKDTKG 773736 Score = 25.0 bits (53), Expect = 9.4 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = -1 Query: 91 EELNAQVEKHKEKLKQLEEEKRRQKIE----MWDSMQEGKSYKGNAKKPQEEDSPGPSTS 146 E+L VEK LKQ +E Q+++ + SM + + + + K Q E++ TS Sbjct: 1959608 EDLRKTVEKWNNLLKQFDENPDVQEVQKTLSLVASMSKDELEESDDVKKQVEETIRRLTS 1959429 Query: 147 SVLKRKS 153 S+ + +S Sbjct: 1959428 SLSEVRS 1959408 >gb|AAGK01000004.1| Theileria parva strain Muguga chromosome 4 ctg_529, whole genome shotgun sequence Length = 1835834 Score = 26.9 bits (58), Expect = 2.5 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = -1 Query: 80 EALAAARLKMQEELNAQVEK-HK--EKLKQLEEEKRRQKIEMWDSMQEGK 126 E +A ++K+ E+++ EK HK EK K EEEKRR EM M++ K Sbjct: 645623 ENMAFDQIKVYIEMDSYEEKMHKKVEKTKVREEEKRR---EMSSKMEKRK 645483 Score = 25.4 bits (54), Expect = 7.2 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 5/81 (6%) Frame = +1 Query: 43 LLYVVFQKLSARLRALRQRQLDRAAAAV-----EPDVVVKRQEALAAARLKMQEELNAQV 97 ++ V +K S R R + R+ AA + +PD + AAA + Q+E+ +V Sbjct: 1512352 VIQVPVKKKSNRGRKAKNRRGPAPAARIPEQPSDPDKSLLDDLTPAAASIDYQQEIVDEV 1512531 Query: 98 EKHKEKLKQLEEEKRRQKIEM 118 + + K ++RQ++ + Sbjct: 1512532 KPPVRRAKSHRTRRKRQEVSL 1512594 >gb|AAGK01000002.1| Theileria parva strain Muguga chromosome 2 chr2_complete, whole genome shotgun sequence Length = 1971884 Score = 26.2 bits (56), Expect = 4.2 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 10/58 (17%) Frame = -1 Query: 92 ELNAQVE---KHKEKLKQLEEEKRRQKIEMWDSMQEGKSYK-------GNAKKPQEED 139 +LN +V+ KH + + +E ++E+W ++ ++YK + KP EED Sbjct: 685235 DLNNEVKCSLKHTSFIDAIGDENEVAEVELWSDAEDLETYKKLYEQIDPDLPKPTEED 685062 Database: genome.fa Posted date: Jan 19, 2010 5:27 PM Number of letters in database: 8,347,606 Number of sequences in database: 9 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,275,891 Number of Sequences: 9 Number of extensions: 14523 Number of successful extensions: 139 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 110 Number of HSP's gapped (non-prelim): 91 length of query: 189 length of database: 2,782,535 effective HSP length: 85 effective length of query: 104 effective length of database: 2,781,770 effective search space: 289304080 effective search space used: 289304080 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)