TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= sel1 selenoprotein1 [Plasmodium falciparum 3D7]; partially from XP_001348206.1 # QUERY (116 letters) Database: genome.fa 4347 sequences; 16,926,281 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Plasmodium_gallinaceum|Pg_2265551.c000410328.Contig1|2007-01-03|... 33 0.016 Plasmodium_gallinaceum|Pg_2265551.c000412575.Contig1|2007-01-03|... 33 0.028 Plasmodium_gallinaceum|Pg_2265551.c000241795.Contig1|2007-01-03|... 32 0.048 Plasmodium_gallinaceum|Pg_2265551.c000013991.Contig1|2007-01-03|... 32 0.063 Plasmodium_gallinaceum|Pg_2265551.c000241388.Contig1|2007-01-03|... 31 0.082 Plasmodium_gallinaceum|Pg_2265551.c000412396.Contig1|2007-01-03|... 31 0.11 Plasmodium_gallinaceum|Pg_2265551.c000012742.Contig1|2007-01-03|... 30 0.14 Plasmodium_gallinaceum|Pg_2265551.c000412509.Contig1|2007-01-03|... 30 0.14 Plasmodium_gallinaceum|Pg_2265551.c000500414.Contig1|2007-01-03|... 30 0.14 Plasmodium_gallinaceum|Pg_2265551.c000128819.Contig1|2007-01-03|... 30 0.14 Plasmodium_gallinaceum|Pg_2265551.c000412662.Contig1|2007-01-03|... 30 0.14 Plasmodium_gallinaceum|Pg_2265551.c000412941.Contig1|2007-01-03|... 30 0.18 Plasmodium_gallinaceum|Pg_2265551.c000412151.Contig1|2007-01-03|... 30 0.24 Plasmodium_gallinaceum|Pg_2265551.c000413400.Contig1|2007-01-03|... 30 0.24 Plasmodium_gallinaceum|Pg_2265551.c000413752.Contig1|2007-01-03|... 30 0.24 Plasmodium_gallinaceum|Pg_2265551.c000413865.Contig1|2007-01-03|... 30 0.24 Plasmodium_gallinaceum|Pg_2265551.c000410268.Contig1.0|2007-01-0... 30 0.24 Plasmodium_gallinaceum|Pg_2265551.c000412730.Contig1|2007-01-03|... 30 0.24 Plasmodium_gallinaceum|Pg_2265551.c000410201.Contig4.0|2007-01-0... 29 0.31 Plasmodium_gallinaceum|Pg_2265551.c000410305.Contig1|2007-01-03|... 29 0.31 Plasmodium_gallinaceum|Pg_2265551.c000413591.Contig1|2007-01-03|... 29 0.31 Plasmodium_gallinaceum|Pg_2265551.c000320940.Contig1|2007-01-03|... 29 0.31 Plasmodium_gallinaceum|Pg_2265551.c000412606.Contig1|2007-01-03|... 29 0.31 Plasmodium_gallinaceum|Pg_2265551.c000319111.Contig1|2007-01-03|... 29 0.31 Plasmodium_gallinaceum|Pg_2265551.c000316425.Contig1.1|2007-01-0... 29 0.41 Plasmodium_gallinaceum|Pg_2265551.c000500410.Contig1|2007-01-03|... 29 0.41 Plasmodium_gallinaceum|Pg_2265551.c000500416.Contig1|2007-01-03|... 29 0.41 Plasmodium_gallinaceum|Pg_2265551.c000410266.Contig2|2007-01-03|... 29 0.41 Plasmodium_gallinaceum|Pg_2265551.c000413630.Contig1|2007-01-03|... 28 0.53 Plasmodium_gallinaceum|Pg_2265551.c000413868.Contig1|2007-01-03|... 28 0.53 Plasmodium_gallinaceum|Pg_2265551.c000410398.Contig3|2007-01-03|... 28 0.53 Plasmodium_gallinaceum|Pg_2265551.c000242058.Contig1|2007-01-03|... 28 0.53 Plasmodium_gallinaceum|Pg_2265551.c000410370.Contig2|2007-01-03|... 28 0.69 Plasmodium_gallinaceum|Pg_2265551.c000411905.Contig1|2007-01-03|... 28 0.69 Plasmodium_gallinaceum|Pg_2265551.c000410421.Contig4|2007-01-03|... 28 0.69 Plasmodium_gallinaceum|Pg_2265551.c000413765.Contig1|2007-01-03|... 28 0.69 Plasmodium_gallinaceum|Pg_2265551.c000412960.Contig1|2007-01-03|... 28 0.69 Plasmodium_gallinaceum|Pg_2265551.c000413270.Contig1|2007-01-03|... 28 0.69 Plasmodium_gallinaceum|Pg_2265551.c000500395.Contig1|2007-01-03|... 28 0.90 Plasmodium_gallinaceum|Pg_2265551.c000413825.Contig1.1|2007-01-0... 28 0.90 Plasmodium_gallinaceum|Pg_2265551.c000014234.Contig1|2007-01-03|... 28 0.90 Plasmodium_gallinaceum|Pg_2265551.c000410226.Contig3|2007-01-03|... 28 0.90 Plasmodium_gallinaceum|Pg_2265551.c000127728.Contig1|2007-01-03|... 28 0.90 Plasmodium_gallinaceum|Pg_2265551.c000234503.Contig1|2007-01-03|... 27 1.2 Plasmodium_gallinaceum|Pg_2265551.c000412664.Contig1|2007-01-03|... 27 1.2 Plasmodium_gallinaceum|Pg_2265551.c000410264.Contig1|2007-01-03|... 27 1.2 Plasmodium_gallinaceum|Pg_2265551.c000413225.Contig1.2|2007-01-0... 27 1.2 Plasmodium_gallinaceum|Pg_2265551.c000412533.Contig1|2007-01-03|... 27 1.2 Plasmodium_gallinaceum|Pg_2265551.c000411819.Contig1|2007-01-03|... 27 1.2 Plasmodium_gallinaceum|Pg_2265551.c000241800.Contig1|2007-01-03|... 27 1.2 Plasmodium_gallinaceum|Pg_2265551.c000413340.Contig1|2007-01-03|... 27 1.5 Plasmodium_gallinaceum|Pg_2265551.c000241426.Contig1|2007-01-03|... 27 1.5 Plasmodium_gallinaceum|Pg_2265551.c000410387.Contig1|2007-01-03|... 27 1.5 Plasmodium_gallinaceum|Pg_2265551.c000128577.Contig1|2007-01-03|... 27 1.5 Plasmodium_gallinaceum|Pg_2265551.c000128171.Contig1|2007-01-03|... 25 1.7 Plasmodium_gallinaceum|Pg_2265551.c000128105.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000128882.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000321062.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000128123.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000316511.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000013329.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000013391.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000012709.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000320335.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000128729.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000013630.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000412118.Contig1|2007-01-03|... 27 2.0 Plasmodium_gallinaceum|Pg_2265551.c000320911.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000127567.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000012247.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000127659.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000413945.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000319512.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000129683.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000013424.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000012816.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000127673.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000128182.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000413615.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000413069.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000319540.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000319240.Contig1|2007-01-03|... 26 2.6 Plasmodium_gallinaceum|Pg_2265551.c000321013.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000013628.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000413169.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000012366.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000014147.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000127931.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000012251.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000413080.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000413948.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000500317.Contig2|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_Contig16|2007-01-03|ds-DNA|Plasmodium_... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000413726.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_Contig80|2007-01-03|ds-DNA|Plasmodium_... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000320840.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000127798.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000320693.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000129076.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000500375.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000320220.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000241797.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000128696.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000414738.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000413741.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000413647.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000013148.Contig1|2007-01-03|... 26 3.4 Plasmodium_gallinaceum|Pg_2265551.c000413724.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000128890.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000412981.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000128188.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000012483.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000318947.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000321058.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000319909.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000413341.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000410341.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000128146.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000414956.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000242044.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000320782.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000012789.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000241587.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000013388.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000319664.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000413073.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000316536.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000014158.Contig1|2007-01-03|... 25 4.5 Plasmodium_gallinaceum|Pg_2265551.c000500376.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000014074.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000015273.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000320867.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000316400.Contig2|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000413015.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000012372.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000240580.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000412545.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000012664.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000410432.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000318869.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000130089.Contig1|2007-01-03|... 25 5.9 Plasmodium_gallinaceum|Pg_2265551.c000128488.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000127893.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000239613.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000129163.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000413416.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000241671.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000321075.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000411928.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_Contig12|2007-01-03|ds-DNA|Plasmodium_... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000014108.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000013870.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000012333.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000128432.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000410427.Contig3|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000013818.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000410221.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000128194.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000319493.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000320421.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000320187.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000012687.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000320431.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000013130.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000240895.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000412072.Contig1|2007-01-03|... 25 7.6 Plasmodium_gallinaceum|Pg_2265551.c000413429.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000321096.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000241617.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000130157.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000412008.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000242051.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000013489.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000129407.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000013244.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000411869.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000413308.Contig1.3|2007-01-0... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000410381.Contig2|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000413404.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000318769.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000129228.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000413573.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000013861.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_Contig78|2007-01-03|ds-DNA|Plasmodium_... 24 10.0 Plasmodium_gallinaceum|Pg_Contig90|2007-01-03|ds-DNA|Plasmodium_... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000130115.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000415362.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000413114.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000319834.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000413440.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000013057.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000128070.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000128862.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000413651.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000013931.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000413522.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000012621.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000241942.Contig1|2007-01-03|... 24 10.0 Plasmodium_gallinaceum|Pg_2265551.c000320359.Contig1|2007-01-03|... 24 10.0 >Plasmodium_gallinaceum|Pg_2265551.c000410328.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7077 Score = 33.5 bits (75), Expect = 0.016 Identities = 29/69 (42%), Positives = 36/69 (52%), Gaps = 7/69 (10%) Frame = +3 Query: 5 KENKKN-----ADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVIN 57 K+NKKN + FL + KY I N NK I+ NFI+ II FI +IN Sbjct: 984 KKNKKNPLALNVYHS*FLCELN*KYF-IFLHNLKINKIIIKYF*NNFIRFIIFFIYLLIN 1160 Query: 58 ILAIFFKTL 66 IL +FFK L Sbjct: 1161 ILILFFKEL 1187 >Plasmodium_gallinaceum|Pg_2265551.c000412575.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6749 Score = 32.7 bits (73), Expect = 0.028 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = -1 Query: 10 NADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVINILAIFFKTLL 67 N Y IFL + K+ NK ++ I NFI+ II FI +INI+ +FFK L+ Sbjct: 5774 N*KYLIFLHNLKI------------NKILIKYI*NNFIRFIIFFIYLLINIIILFFKELI 5631 >Plasmodium_gallinaceum|Pg_2265551.c000241795.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4904 Score = 32.0 bits (71), Expect = 0.048 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +1 Query: 42 INFIKGIINFIKTVINILAIFFKTLL 67 I FIK +NFI+T+I ++A F+ T++ Sbjct: 4750 ITFIKNTVNFIRTIIIVIATFYITII 4827 >Plasmodium_gallinaceum|Pg_2265551.c000013991.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2421 Score = 31.6 bits (70), Expect = 0.063 Identities = 24/85 (28%), Positives = 40/85 (47%) Frame = -3 Query: 1 MDDRKENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILA 60 +D++ +N + + +++ K KI HN I IN IKG +I Sbjct: 1786 IDEQVDNIEEGNSKLYFSFLNEKELKIIDNAFNHN--IDTDINLIKGCFYNELELIKKNT 1613 Query: 61 IFFKTLLGQSNTSQSSNGKNNDDDD 85 ++ K LL + N ++S N N D+DD Sbjct: 1612 VYTKMLLKKENKNKSKNSDNIDNDD 1538 >Plasmodium_gallinaceum|Pg_2265551.c000241388.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 15714 Score = 31.2 bits (69), Expect = 0.082 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = -2 Query: 13 YEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINF 51 Y+IF+ D K+KY+ I +H L I+ +K IINF Sbjct: 6590 YDIFMNDLKIKYK*IFLL*KIHFYLFLSILKEVKVIINF 6474 >Plasmodium_gallinaceum|Pg_2265551.c000412396.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4200 Score = 30.8 bits (68), Expect = 0.11 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 6/41 (14%) Frame = +2 Query: 32 ALHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 +LHN I ++ NFI+ II FI +INIL +FFK L Sbjct: 593 SLHNIKINKVLIGYFQNNFIRFIIFFIYLLINILILFFKEL 715 >Plasmodium_gallinaceum|Pg_2265551.c000012742.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3691 Score = 30.4 bits (67), Expect = 0.14 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +3 Query: 68 GQSNTSQSSNGKNNDDDDGFFKKK----RTGGLPKSRIMELKN 106 G SNTS SSN KNN+ D FF + P S+I+ N Sbjct: 471 GSSNTSNSSNNKNNNLFDYFFSNSSGITKYTAYPISQILNYSN 599 >Plasmodium_gallinaceum|Pg_2265551.c000412509.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3980 Score = 30.4 bits (67), Expect = 0.14 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +3 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ II FI +INIL +FFK L Sbjct: 2982 NFIRFIIFFIYLLINILILFFKEL 3053 >Plasmodium_gallinaceum|Pg_2265551.c000500414.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5987 Score = 30.4 bits (67), Expect = 0.14 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ II FI +INIL +FFK L Sbjct: 5056 NFIRFIIFFIYLLINILILFFKEL 4985 >Plasmodium_gallinaceum|Pg_2265551.c000128819.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2727 Score = 30.4 bits (67), Expect = 0.14 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 4/51 (7%) Frame = +1 Query: 7 NKKNADYEIFLRDRKLK----YEKIRKRNALHNKFILPIINFIKGIINFIK 53 N KN +I+ D+K + ++K N N+F L ++N+ G INFIK Sbjct: 1243 NFKNYLNQIYYLDKKNDNIPIIKVVKKTNESRNRFNLYLMNYRNGAINFIK 1395 >Plasmodium_gallinaceum|Pg_2265551.c000412662.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4110 Score = 30.4 bits (67), Expect = 0.14 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 6/40 (15%) Frame = +2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I+ I+ N I+ II FI +INIL +FFK L Sbjct: 1088 LHNIKIIKILIKYF*NNIIRFIIFFIYLLINILILFFKEL 1207 >Plasmodium_gallinaceum|Pg_2265551.c000412941.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2767 Score = 30.0 bits (66), Expect = 0.18 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 9/88 (10%) Frame = +3 Query: 12 DYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIIN---FIKTVINILAIFF---KT 65 D+E ++ + +K E +++ NK ++ I+F N + +NIL +FF K Sbjct: 1149 DFENAIKMKSIKKEVKKQKKKKINKIVVKEIHFKSLKYNNNYYFVPSLNILRLFFNCRKH 1328 Query: 66 LLGQSNTS---QSSNGKNNDDDDGFFKK 90 L +S ++ N N+D++ FF+K Sbjct: 1329 LCCESYKKLIEKNENDVKNEDEENFFRK 1412 >Plasmodium_gallinaceum|Pg_2265551.c000412151.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8000 Score = 29.6 bits (65), Expect = 0.24 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI+ II FI INIL +FFK L Sbjct: 318 LHNLKINKILI*YF*NNFIRFIIFFIYL*INILILFFKNL 437 >Plasmodium_gallinaceum|Pg_2265551.c000413400.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 9095 Score = 29.6 bits (65), Expect = 0.24 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI+ II FI INIL +FFK L Sbjct: 698 LHNLKISKILIKYF*NNFIRFIIFFIYL*INILILFFKEL 817 >Plasmodium_gallinaceum|Pg_2265551.c000413752.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11673 Score = 29.6 bits (65), Expect = 0.24 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 7/70 (10%) Frame = +3 Query: 4 RKENKK-----NADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVI 56 +K+NKK N + FL KY I N NK ++ I NF++ II FI I Sbjct: 621 KKKNKKSPLSLNVYHL*FLCPLN*KY-LILLYNLKINKILIKYI*NNFMRFIIFFIYL*I 797 Query: 57 NILAIFFKTL 66 NIL +FFK L Sbjct: 798 NILILFFKDL 827 >Plasmodium_gallinaceum|Pg_2265551.c000413865.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7792 Score = 29.6 bits (65), Expect = 0.24 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI+ II FI INIL +FFK L Sbjct: 1500 LHNLKINKILI*YF*NNFIRFIIFFIYL*INILILFFKNL 1619 >Plasmodium_gallinaceum|Pg_2265551.c000410268.Contig1.0|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2905 Score = 29.6 bits (65), Expect = 0.24 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +1 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI+ II FI INIL +FFK L Sbjct: 1291 LHNLKINKILI*YF*NNFIRFIIFFIYL*INILILFFKNL 1410 >Plasmodium_gallinaceum|Pg_2265551.c000412730.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1109 Score = 29.6 bits (65), Expect = 0.24 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = -3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI+ II FI INIL +FFK L Sbjct: 585 LHNLKISKILIKYF*NNFIRFIIFFIYL*INILILFFKEL 466 >Plasmodium_gallinaceum|Pg_2265551.c000410201.Contig4.0|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 39960 Score = 29.3 bits (64), Expect = 0.31 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 27 IRKRNALHNKFILPII--NFIKGIINFIKTVINILAIFFKTL 66 I N NK ++ NFI II FI +INIL +FFK L Sbjct: 36485 IFSHNLKLNKILIKYF*NNFILFIIFFIYLLINILILFFKEL 36610 Score = 28.9 bits (63), Expect = 0.41 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +1 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ N I+ II FI +INIL +FFK L Sbjct: 2983 LHNLKINKILIECF*NNIIRFIIFFIYLLINILILFFKEL 3102 >Plasmodium_gallinaceum|Pg_2265551.c000410305.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5336 Score = 29.3 bits (64), Expect = 0.31 Identities = 20/52 (38%), Positives = 30/52 (57%) Frame = +2 Query: 12 DYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF 63 D FL+ +K+K EK ++ KF + I F++ I F +VINI+ IFF Sbjct: 1457 DIFYFLKKKKIK*EKFFRKK----KFHVNIF*FLR--IKFSLSVINIIKIFF 1594 >Plasmodium_gallinaceum|Pg_2265551.c000413591.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 17589 Score = 29.3 bits (64), Expect = 0.31 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -2 Query: 22 LKYEKIRKRNALHNKFILPIIN 43 +KY KIRK+N +H+ I+ IIN Sbjct: 1913 IKYGKIRKKNGMHSCIIIIIIN 1848 >Plasmodium_gallinaceum|Pg_2265551.c000320940.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7036 Score = 29.3 bits (64), Expect = 0.31 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -3 Query: 27 IRKRNALHNKFILPII--NFIKGIINFIKTVINILAIFFKTL 66 I N NK ++ NFI II FI +INIL +FFK L Sbjct: 5924 IFSHNLKLNKILIKYF*NNFILFIIFFIYLLINILILFFKKL 5799 >Plasmodium_gallinaceum|Pg_2265551.c000412606.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6692 Score = 29.3 bits (64), Expect = 0.31 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +2 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ II FI + INIL +FFK L Sbjct: 527 NFIRFIIFFIYS*INILILFFKEL 598 Score = 29.3 bits (64), Expect = 0.31 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 21 KLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLL 67 K KY+K + R L F + + + K II F+ T+I L FFK L Sbjct: 5659 KSKYKKKKYRYILLFFFFVVTLTWKKKIIYFLLTIIFFLLFFFKNNL 5799 >Plasmodium_gallinaceum|Pg_2265551.c000319111.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 12387 Score = 29.3 bits (64), Expect = 0.31 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 3/104 (2%) Frame = +3 Query: 7 NKKNADYEIFLRDRKLKYEKIRKRNALH--NKFILPIINFIKGII-NFIKTVINILAIFF 63 NKK D E F + L EK RK+N NK IN + N+ K V N+L Sbjct: 8490 NKKMEDSEKFYIENDLNSEKKRKKNEHDDCNKVKNNSINDEDTLYDNYCKNVDNVLNKLE 8669 Query: 64 KTLLGQSNTSQSSNGKNNDDDDGFFKKKRTGGLPKSRIMELKNL 107 N + +DD+ +F KK + + +E+ N+ Sbjct: 8670 NIDNHNDNYCIENKTYVKEDDEDYFSKKENKHNYEEKKIEINNI 8801 >Plasmodium_gallinaceum|Pg_2265551.c000316425.Contig1.1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5185 Score = 28.9 bits (63), Expect = 0.41 Identities = 27/66 (40%), Positives = 34/66 (51%), Gaps = 7/66 (10%) Frame = -3 Query: 5 KENKKN-----ADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVIN 57 K+NKKN A + FLR KY I N NK ++ NF++ II FI IN Sbjct: 4988 KKNKKNPLTLNAYHL*FLRTLN*KYF-IFLHNLKINKILIKYF*NNFMRFIIFFIYL*IN 4812 Query: 58 ILAIFF 63 IL +FF Sbjct: 4811 ILILFF 4794 >Plasmodium_gallinaceum|Pg_2265551.c000500410.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7542 Score = 28.9 bits (63), Expect = 0.41 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = +3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ N I+ II FI +INIL +FFK L Sbjct: 537 LHNLKINKILIKYFKNNLIRFIIFFIYLLINILILFFKEL 656 >Plasmodium_gallinaceum|Pg_2265551.c000500416.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 10761 Score = 28.9 bits (63), Expect = 0.41 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = -2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI+ + FI +INIL +FFK L Sbjct: 4889 LHNLKINKILIEYF*NNFIRFVTFFIYLLINILILFFKDL 4770 >Plasmodium_gallinaceum|Pg_2265551.c000410266.Contig2|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6835 Score = 28.9 bits (63), Expect = 0.41 Identities = 27/66 (40%), Positives = 34/66 (51%), Gaps = 7/66 (10%) Frame = -3 Query: 5 KENKKN-----ADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVIN 57 K+NKKN A + FLR KY I N NK ++ NF++ II FI IN Sbjct: 2609 KKNKKNPLTLNAYHL*FLRTLN*KYF-IFLHNLKINKILIKYF*NNFMRFIIFFIYL*IN 2433 Query: 58 ILAIFF 63 IL +FF Sbjct: 2432 ILILFF 2415 >Plasmodium_gallinaceum|Pg_2265551.c000413630.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4828 Score = 28.5 bits (62), Expect = 0.53 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ II F+ +INI+ +FFK L Sbjct: 1704 NFIRFIIFFMYLLINIIILFFKEL 1775 >Plasmodium_gallinaceum|Pg_2265551.c000413868.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 16861 Score = 28.5 bits (62), Expect = 0.53 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 6/37 (16%) Frame = -2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFF 63 LHN I I+ NFI+ II FI +INIL FF Sbjct: 8769 LHNLKINKILIKYF*KNFIRSIIFFIYLLINILIFFF 8659 >Plasmodium_gallinaceum|Pg_2265551.c000410398.Contig3|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 19356 Score = 28.5 bits (62), Expect = 0.53 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -1 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 +FI+ II FI +INIL +FFK L Sbjct: 14502 SFIRFIIFFIYMLINILILFFKEL 14431 >Plasmodium_gallinaceum|Pg_2265551.c000242058.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2379 Score = 28.5 bits (62), Expect = 0.53 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 6/61 (9%) Frame = +2 Query: 48 IINFIKTVINILAIFFKTLLGQSNTS------QSSNGKNNDDDDGFFKKKRTGGLPKSRI 101 + N KT + +F +G NT+ QSSNG N+D KKK + L K+ I Sbjct: 164 LANIEKTCDFYIKKYFSDDIGDENTTMETDKIQSSNGNQNNDLINLKKKKNSFLLMKNEI 343 Query: 102 M 102 + Sbjct: 344 L 346 >Plasmodium_gallinaceum|Pg_2265551.c000410370.Contig2|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 12642 Score = 28.1 bits (61), Expect = 0.69 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = -2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI+ II FI INI +FFK L Sbjct: 6623 LHNLKINKILIKYF*NNFIRFIIFFIYL*INIFILFFKVL 6504 Score = 24.6 bits (52), Expect = 7.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 N I+ II FI INI +FFK L Sbjct: 12536 NLIRFIIFFIYL*INIFILFFKEL 12465 >Plasmodium_gallinaceum|Pg_2265551.c000411905.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4957 Score = 28.1 bits (61), Expect = 0.69 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 7/69 (10%) Frame = +2 Query: 5 KENKKNA----DYEI-FLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVIN 57 K+NKKN Y + FL KY I N+ NK ++ NFI+ II FI IN Sbjct: 557 KKNKKNPLTLNVYHL*FLYALNKKY-LIFLNNSKINKILIKYF*NNFIRFIIFFIYL*IN 733 Query: 58 ILAIFFKTL 66 + +FFK L Sbjct: 734 VHILFFKEL 760 >Plasmodium_gallinaceum|Pg_2265551.c000410421.Contig4|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 16027 Score = 28.1 bits (61), Expect = 0.69 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -2 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ II FI + INIL +FFK + Sbjct: 14244 NFIRIIIFFIYS*INILILFFKEI 14173 Score = 25.4 bits (54), Expect = 4.5 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Frame = -2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFK 64 LHN I II NFI II FI INIL FFK Sbjct: 7614 LHNLKINKIIIKYF*NNFILFIIYFIYL*INILI*FFK 7501 >Plasmodium_gallinaceum|Pg_2265551.c000413765.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 14054 Score = 28.1 bits (61), Expect = 0.69 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +3 Query: 10 NADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVINILAIFFKTL 66 N +Y IFL + K+ NK ++ NFI+ II FI INI +FFK L Sbjct: 417 N*EYLIFLHNLKI------------NKILIKWF*NNFIRFIIFFIYL*INIFILFFKEL 557 >Plasmodium_gallinaceum|Pg_2265551.c000412960.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3995 Score = 28.1 bits (61), Expect = 0.69 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 7/69 (10%) Frame = +3 Query: 5 KENKKNA----DYEI-FLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVIN 57 K+NKKN Y + FL KY I N+ NK ++ NFI+ II FI IN Sbjct: 1392 KKNKKNPLTLNVYHL*FLYALNKKY-LIFLNNSKINKILIKYF*NNFIRFIIFFIYL*IN 1568 Query: 58 ILAIFFKTL 66 + +FFK L Sbjct: 1569 VHILFFKEL 1595 >Plasmodium_gallinaceum|Pg_2265551.c000413270.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8581 Score = 28.1 bits (61), Expect = 0.69 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 7/69 (10%) Frame = -3 Query: 5 KENKKNA----DYEI-FLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVIN 57 K+NKKN Y + FL KY I N+ NK ++ NFI+ II FI IN Sbjct: 6650 KKNKKNPLTLNVYHL*FLYALNKKY-LIFLNNSKINKILIKYF*NNFIRFIIFFIYL*IN 6474 Query: 58 ILAIFFKTL 66 + +FFK L Sbjct: 6473 VHILFFKEL 6447 >Plasmodium_gallinaceum|Pg_2265551.c000500395.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7365 Score = 27.7 bits (60), Expect = 0.90 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -2 Query: 22 LKYEKIRKRNALHNKFILPIIN 43 +KY KIRK+N +++ IL IIN Sbjct: 3488 IKYGKIRKKNGIYSCIILIIIN 3423 >Plasmodium_gallinaceum|Pg_2265551.c000413825.Contig1.1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 15282 Score = 27.7 bits (60), Expect = 0.90 Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = -3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI II FI INIL +FFK L Sbjct: 11719 LHNLKINKILIKYF*NNFILFIIFFIYL*INILILFFKDL 11600 Score = 27.7 bits (60), Expect = 0.90 Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = -1 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI II FI INIL +FFK L Sbjct: 1518 LHNLKINKILIKYF*NNFILFIIFFIYL*INILILFFKDL 1399 >Plasmodium_gallinaceum|Pg_2265551.c000014234.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4208 Score = 27.7 bits (60), Expect = 0.90 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = +1 Query: 7 NKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGII 49 NK DY IFL+ K+ I+K+N K+I +I FIK II Sbjct: 1012 NKI*LDYYIFLK*GKI----IKKKN*YMTKYIRCMIIFIKNII 1128 >Plasmodium_gallinaceum|Pg_2265551.c000410226.Contig3|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11295 Score = 27.7 bits (60), Expect = 0.90 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = -3 Query: 10 NADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVINILAIFFKTL 66 N Y IFL + KL NK ++ NFI+ II FI IN+ +FFK L Sbjct: 3943 N*KYLIFLHNLKL------------NKILIKFF*NNFIQFIIFFIYL*INVFNLFFKEL 3803 Score = 27.3 bits (59), Expect = 1.2 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI II FI INIL +FFK L Sbjct: 10119 NFILFIIFFIYLKINILNLFFKEL 10048 >Plasmodium_gallinaceum|Pg_2265551.c000127728.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2490 Score = 27.7 bits (60), Expect = 0.90 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 9 KNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIF 62 KN +Y + + K +K RK+ ++ FIK +I F+K I +IF Sbjct: 409 KNINYSNKFNNNEFKLKKKRKKKENNHWMKFSTSKFIKKVILFLKEKIKYKSIF 570 >Plasmodium_gallinaceum|Pg_2265551.c000234503.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7680 Score = 27.3 bits (59), Expect = 1.2 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +3 Query: 6 ENKKNADYEIFLRDRKLKYEKIRKRNALHNKFIL 39 E KKN + + ++++K K +K RK + +N+FIL Sbjct: 6792 EKKKNNNKKKIIKEKKKKKKK*RKFYSYNNQFIL 6893 >Plasmodium_gallinaceum|Pg_2265551.c000412664.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5101 Score = 27.3 bits (59), Expect = 1.2 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 N I+ II FI +INIL +FFK + Sbjct: 921 NIIRFIIFFIYLLINILILFFKEI 992 >Plasmodium_gallinaceum|Pg_2265551.c000410264.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4896 Score = 27.3 bits (59), Expect = 1.2 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -2 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI II FI INIL +FFK L Sbjct: 3716 NFILFIIFFIYLKINILNLFFKEL 3645 >Plasmodium_gallinaceum|Pg_2265551.c000413225.Contig1.2|2007-01- 03|ds-DNA|Plasmodium_gallinaceum_Sanger Length = 1501 Score = 27.3 bits (59), Expect = 1.2 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ FI+ II FI INIL +FFK L Sbjct: 518 LHNLEISKILITYF*NKFIRFIIFFIYL*INILILFFKDL 637 >Plasmodium_gallinaceum|Pg_2265551.c000412533.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 14051 Score = 27.3 bits (59), Expect = 1.2 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +1 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ N I II FI +INIL +FFK L Sbjct: 7273 LHNLKINKILIKYF*NNIILFIIFFIYLLINILILFFKEL 7392 >Plasmodium_gallinaceum|Pg_2265551.c000411819.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6399 Score = 27.3 bits (59), Expect = 1.2 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +2 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI II FI INIL +FFK L Sbjct: 5321 NFILFIIFFIYLKINILNLFFKEL 5392 >Plasmodium_gallinaceum|Pg_2265551.c000241800.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8967 Score = 27.3 bits (59), Expect = 1.2 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Frame = +1 Query: 20 RKLKYEKIRKRNALHNKFILPIINFI-----KGIINFIKTVINILAIFFKTLLGQ 69 +K K KI K+ L+NKF + +IN + K N+I+ INI IFF L + Sbjct: 7558 KKKKKRKI-KQK*LNNKFCIYVINCMKKKKKKKKKNYIRNQINI*KIFFFFFLNE 7719 >Plasmodium_gallinaceum|Pg_2265551.c000413340.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5546 Score = 26.9 bits (58), Expect = 1.5 Identities = 19/51 (37%), Positives = 28/51 (54%) Frame = +1 Query: 13 YEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF 63 Y +F K+K EK ++ KF + I F++ I F +VINI+ IFF Sbjct: 1738 YILFFIKNKIK*EKFFRKK----KFHVNIF*FLR--IKFSLSVINIIKIFF 1872 Score = 25.8 bits (55), Expect = 3.4 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Frame = +1 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFK 64 LHN I II NFI+ II I INIL FFK Sbjct: 430 LHNLKINKIIIKYF*NNFIRFIIYVIYL*INILIFFFK 543 >Plasmodium_gallinaceum|Pg_2265551.c000241426.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4028 Score = 26.9 bits (58), Expect = 1.5 Identities = 16/53 (30%), Positives = 30/53 (56%) Frame = +1 Query: 4 RKENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVI 56 +K+ KK I + +K+K + I+K+N +H I+ ++ K FIKT++ Sbjct: 3346 KKKMKKKQMKIIKILKKKMKQK*IKKKNYIHLWRIIKLLLLKKDHC*FIKTMV 3504 >Plasmodium_gallinaceum|Pg_2265551.c000410387.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 13632 Score = 26.9 bits (58), Expect = 1.5 Identities = 20/40 (50%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI II FI INIL +FFK L Sbjct: 4013 LHNLKINKILIKYF*NNFI*FIIFFIYL*INILILFFKEL 4132 >Plasmodium_gallinaceum|Pg_2265551.c000128577.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1962 Score = 26.9 bits (58), Expect = 1.5 Identities = 22/66 (33%), Positives = 29/66 (43%) Frame = -3 Query: 26 KIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLLGQSNTSQSSNGKNNDDDD 85 KI++R A N FI II F I +F +IN F + +N KNN Sbjct: 1954 KIKER*A--NFFIFIIILFPFNIFSFTNYLINYFFFFLNIFKN*KKKKKKNNVKNNFYYI 1781 Query: 86 GFFKKK 91 +KKK Sbjct: 1780 FIYKKK 1763 >Plasmodium_gallinaceum|Pg_2265551.c000128171.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2660 Score = 24.6 bits (52), Expect(2) = 1.7 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 42 INFIKGIINFIKTVINILAIFFKTLLGQSN 71 INF+ I I +INIL IFF T+ +SN Sbjct: 196 INFLY-IFLLIVFLINILIIFF*TIFDKSN 282 Score = 20.4 bits (41), Expect(2) = 1.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 21 KLKYEKIRKRNALHNKFILPIINF 44 KL Y+ I+ HN I+NF Sbjct: 102 KL*YKNIKSIALFHNNIFSGILNF 173 >Plasmodium_gallinaceum|Pg_2265551.c000128105.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4968 Score = 26.6 bits (57), Expect = 2.0 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%) Frame = -2 Query: 3 DRKENKKNADYE--IFLRDRKLKYEKIRKR 30 ++K NKKN D E +F ++ K KY KI ++ Sbjct: 773 NKKWNKKNEDNERFVFKKNVKYKYSKINEK 684 >Plasmodium_gallinaceum|Pg_2265551.c000128882.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3834 Score = 26.6 bits (57), Expect = 2.0 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 5/68 (7%) Frame = +2 Query: 20 RKLKYEKIRKRNALHNKFI----LPIINFIK-GIINFIKTVINILAIFFKTLLGQSNTSQ 74 R ++Y +N F+ +P +N+ IINF+ + KTL + N + Sbjct: 1070 RLVRYSPFNAQNKRMTSFVKVDVIPTLNYNDVNIINFLNNAEKTSSKNNKTLEKEKNNNN 1249 Query: 75 SSNGKNND 82 ++N NN+ Sbjct: 1250 NNNNNNNN 1273 >Plasmodium_gallinaceum|Pg_2265551.c000321062.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 9182 Score = 26.6 bits (57), Expect = 2.0 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 3/79 (3%) Frame = -2 Query: 8 KKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFI---KTVINILAIFFK 64 K+ ++ +I RD KY+K + L + ILPI++ I+ KT INI I Sbjct: 7681 KEKSNKKINSRDLMEKYKKCMRLFNLASIIILPILSMTVSIVALSTSEKTYINISNIITS 7502 Query: 65 TLLGQSNTSQSSNGKNNDD 83 L ++ S N D+ Sbjct: 7501 LYLVLNSILLSDLRSNKDN 7445 >Plasmodium_gallinaceum|Pg_2265551.c000128123.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5379 Score = 26.6 bits (57), Expect = 2.0 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +3 Query: 37 FILPIINFIKGIINFIKTVINILAIFF 63 F IINFI II+F KTVI +++ FF Sbjct: 4710 F*FKIINFIFFIIHFFKTVI-LISFFF 4787 >Plasmodium_gallinaceum|Pg_2265551.c000316511.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6345 Score = 26.6 bits (57), Expect = 2.0 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +3 Query: 8 KKNADYEIFLRDRKLKYEK-IRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTL 66 KK + IF ++ + + +K+N ++N +L IIN I I N+I +F+K+ Sbjct: 4644 KKKKYFVIFFKNVTMNFNF*KKKKNKINNMILLFIINSILTITNYI--------LFYKSF 4799 Query: 67 L 67 L Sbjct: 4800 L 4802 >Plasmodium_gallinaceum|Pg_2265551.c000013329.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3215 Score = 26.6 bits (57), Expect = 2.0 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +3 Query: 25 EKIRKRNALHNKFILPIINFIKGIINF-IKTVINILAIFFKTL 66 EKI+K+NA+ +K L + FI I N+ I N+ FF TL Sbjct: 879 EKIKKKNAIIHKIELIFLIFI--INNYLINIYFNMYLFFFATL 1001 >Plasmodium_gallinaceum|Pg_2265551.c000013391.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5241 Score = 26.6 bits (57), Expect = 2.0 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +3 Query: 24 YEKIRKRNALHNKFILPIINFIKGIINFIKTVI--NILAIFFK 64 + + +K+N HN F++ +I I ++ F+ I ++L+IF K Sbjct: 2679 FHEFKKKNCYHNFFLINVIFLIFNLLYFLFKSIYKHVLSIF*K 2807 >Plasmodium_gallinaceum|Pg_2265551.c000012709.Contig1|2007-01- 03|ds-DNA|Plasmodium_gallinaceum_Sanger Length = 3378 Score = 26.6 bits (57), Expect = 2.0 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 5/70 (7%) Frame = +1 Query: 15 IFLRDRKLKYEKIRKRNALHNKFILPIINFIKG--IINFIKTVI---NILAIFFKTLLGQ 69 IFL+ +K +K+RKR K I IIN +K IN +K I + F+TL+ + Sbjct: 16 IFLKKKK---KKLRKRIFNFKKNIFIIINIMKNYLYINHLKKFIENEKLALPNFETLMEE 186 Query: 70 SNTSQSSNGK 79 + N K Sbjct: 187EEKKEQDNKK 216 >Plasmodium_gallinaceum|Pg_2265551.c000320335.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5117 Score = 26.6 bits (57), Expect = 2.0 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 33 LHNKFILPIINFIKGIINFIKTVINILAIFFKTLLGQSNTSQSSNGKNNDDDD 85 L N L II + G++N K + F+K L+ + + S+ + ND+ + Sbjct: 3030 LENSKFLSIIPYAIGLVNNKKIFDMLFNTFYKKLVTKRKKKKKSDNECNDEKE 3188 >Plasmodium_gallinaceum|Pg_2265551.c000128729.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1977 Score = 26.6 bits (57), Expect = 2.0 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 7/54 (12%) Frame = -1 Query: 7 NKKN-------ADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIK 53 NKKN + +IFL+ R K +K K + N PII +K +IN+ K Sbjct: 444 NKKN*IFFLN*PNTQIFLKKRGFKKKK--KLGEIKNGAKFPIILILKKLINYFK 289 >Plasmodium_gallinaceum|Pg_2265551.c000013630.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3537 Score = 26.6 bits (57), Expect = 2.0 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Frame = -2 Query: 4 RKENKKNADYEIFLRDRKLKYEKIRK-RNALHNKFILPIINFIKGIINFIKTVINILAIF 62 +K+ +K +FL+ KL+ EKI+K +N L FIL + F+K +N K NI F Sbjct: 461 KKKKEKKKKNSLFLKRYKLR-EKIKKIKNYL*TFFIL*LKIFLKWNLNGGKK--NIFFFF 291 Query: 63 F 63 F Sbjct: 290 F 288 >Plasmodium_gallinaceum|Pg_2265551.c000412118.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7151 Score = 26.6 bits (57), Expect = 2.0 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 19 DRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAI 61 D LKY+KI ++++ +F II FIK IN +INIL + Sbjct: 223 D*NLKYDKIFVKSSV**RFF--II*FIKDNINNNSLIINILTL 345 >Plasmodium_gallinaceum|Pg_2265551.c000320911.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 9181 Score = 26.2 bits (56), Expect = 2.6 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = -3 Query: 14 EIFLRDRKLKYEKIRKRNALHNKFILPIINFI------KGIINFIKTVINILAI 61 +I + RKLK +KIR+R K I I + K I+ IK+ I I+ + Sbjct: 3155 KILKKKRKLKIKKIRRRKMKMEKVIKS*IKIVKVKKRRKNIMKVIKS*IKIVKV 2994 >Plasmodium_gallinaceum|Pg_2265551.c000127567.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7508 Score = 26.2 bits (56), Expect = 2.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 5 KENKKNADYEIFLRDRKLKYEKIRKRNALHNKFI 38 K+ KKN + ++ + + ++Y K KRN +H K + Sbjct: 4414 KKKKKNINSQVVMGIKMIEY*KRIKRNIIHVKIL 4515 >Plasmodium_gallinaceum|Pg_2265551.c000012247.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4571 Score = 26.2 bits (56), Expect = 2.6 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 16 FLRDRKLKYEKIRKRNALHNKFILPIINF 44 FL+DRK +++ KRN LH+ F+ I+ F Sbjct: 1412 FLKDRK---KRVYKRNYLHDFFLYVILFF 1489 >Plasmodium_gallinaceum|Pg_2265551.c000127659.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1463 Score = 26.2 bits (56), Expect = 2.6 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 8/38 (21%) Frame = +3 Query: 16 FLRDRKLKYEKIRKRNA--------LHNKFILPIINFI 45 F + +KLK EKI KRN +H K IL II ++ Sbjct: 201 FKKKKKLKKEKILKRNKKANI*FNYMHKKIIL*IIIYL 314 >Plasmodium_gallinaceum|Pg_2265551.c000413945.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 15447 Score = 26.2 bits (56), Expect = 2.6 Identities = 28/69 (40%), Positives = 34/69 (49%), Gaps = 7/69 (10%) Frame = +3 Query: 5 KENKK-----NADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVIN 57 K+NKK N + FL K KY I N NK I+ FI+ II +I IN Sbjct: 1521 KKNKKKPLTLNVYHL*FLYALKKKY*-ISLHNLEINKNIIKYF*NIFIRFIIFYIYL*IN 1697 Query: 58 ILAIFFKTL 66 IL +FFK L Sbjct: 1698 ILILFFKEL 1724 Score = 26.2 bits (56), Expect = 2.6 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = +2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ NFI II F + INIL +FFK L Sbjct: 9470 LHNLKINEILIKYF*NNFILFIIFFSYS*INILILFFKDL 9589 >Plasmodium_gallinaceum|Pg_2265551.c000319512.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6959 Score = 26.2 bits (56), Expect = 2.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 34 HNKFILPIINFIKGIINFIKTVINILAIFF 63 HN FI PI NFI I N ++ I FF Sbjct: 5388 HNYFIWPICNFIILIFNIYSYLVFISFPFF 5477 >Plasmodium_gallinaceum|Pg_2265551.c000129683.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1992 Score = 26.2 bits (56), Expect = 2.6 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = -3 Query: 16 FLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVI-NILAIFFKTLLGQSNTSQ 74 F + LKY + RKRNA + IN +N ++I F+K S T + Sbjct: 1927 FYSTQSLKYSETRKRNASLWDYNNDKINVKSSFLNHSGSIIKRKKEKFYK----NSGTYE 1760 Query: 75 SSNGKNNDDDDGFFKK 90 NDD D +KK Sbjct: 1759 LGRTHTNDDCDNKWKK 1712 >Plasmodium_gallinaceum|Pg_2265551.c000013424.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3680 Score = 26.2 bits (56), Expect = 2.6 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 8/57 (14%) Frame = +1 Query: 18 RDRKLKYEKIRKRNALHNKFILPIINFIK--------GIINFIKTVINILAIFFKTL 66 + +K++Y+K +K N L+ + +INF+K +FIK N+L FKTL Sbjct: 3418 KKKKIRYKKKKKNN*LNKILKIFLINFLKIKKKF*NLKKNDFIKISYNLLK--FKTL 3582 >Plasmodium_gallinaceum|Pg_2265551.c000012816.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4296 Score = 26.2 bits (56), Expect = 2.6 Identities = 30/103 (29%), Positives = 44/103 (42%), Gaps = 15/103 (14%) Frame = -2 Query: 6 ENKKNADYEI-FLRDRKL---KYEKIRKRNALHNKFILPIINFIKGIIN----------- 50 EN+K +Y F++ L K EKI + + F ++ K +IN Sbjct: 2378 ENQKKKNYITKFIKSESLDRNKGEKINLKESSFTNFCRKEVSEKKHLINHFDEKKKKKNI 2199 Query: 51 FIKTVINILAIFFKTLLGQSNTSQSSNGKNNDDDDGFFKKKRT 93 F+K NIL+ F TL T++ N N D KKK+T Sbjct: 2198 FVKKDKNILSSFKNTLNNFKKTNKVVN-PNIKHSDKKTKKKKT 2073 >Plasmodium_gallinaceum|Pg_2265551.c000127673.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3279 Score = 26.2 bits (56), Expect = 2.6 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 5/36 (13%) Frame = -1 Query: 33 LHN-KFILPIINFIKGIINFIKTVINILA----IFF 63 LHN KFI+ ++N I+ FIK + N+L+ IFF Sbjct: 1806 LHNIKFIIRLLNIFFFILLFIKLIKNLLSRKM*IFF 1699 >Plasmodium_gallinaceum|Pg_2265551.c000128182.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2585 Score = 26.2 bits (56), Expect = 2.6 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +3 Query: 20 RKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLL 67 +KLK +K ++ H +IL + ++NF++ V+NIL FK + Sbjct: 843 KKLKKKKKKELIKRHLIYIL----YWNQLVNFLEKVLNILIRIFKNFI 974 >Plasmodium_gallinaceum|Pg_2265551.c000413615.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 10951 Score = 26.2 bits (56), Expect = 2.6 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 44 FIKGIINFIKTVINILAIFFKTL 66 FI+ II FI +INIL +FF L Sbjct: 4676 FIRFIIFFIYLLINILILFFNEL 4744 >Plasmodium_gallinaceum|Pg_2265551.c000413069.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3668 Score = 26.2 bits (56), Expect = 2.6 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 44 FIKGIINFIKTVINILAIFFKTL 66 FI+ II FI +INIL +FF L Sbjct: 78 FIRFIIFFIYLLINILILFFNEL 146 >Plasmodium_gallinaceum|Pg_2265551.c000319540.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5851 Score = 26.2 bits (56), Expect = 2.6 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 6/43 (13%) Frame = +2 Query: 23 KYEKIRKRNALHNKFILPIINFI------KGIINFIKTVINIL 59 KYE +K+ L NK++L I+F + IN+IK ++ I+ Sbjct: 3872 KYEL*KKKKYLFNKYLLQYISFRE**ML*ELSINYIKVILYII 4000 >Plasmodium_gallinaceum|Pg_2265551.c000319240.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5080 Score = 26.2 bits (56), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 31 NALHNKFILPIINFIKGIINFIKTVINILAIFFKTLL 67 N LH L NFIK + ++K ++NIL F ++ Sbjct: 2312 NNLHVLI*LFKYNFIKKLYLYLKIILNILLFIFNIII 2422 >Plasmodium_gallinaceum|Pg_2265551.c000321013.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1913 Score = 25.8 bits (55), Expect = 3.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 35 NKFILPIINFIKGIINFIKTVINI 58 NKFI I+NFIK + F+ I+I Sbjct: 293 NKFIHRILNFIKNKLKFLFNYIDI 222 >Plasmodium_gallinaceum|Pg_2265551.c000013628.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4428 Score = 25.8 bits (55), Expect = 3.4 Identities = 29/96 (30%), Positives = 35/96 (36%), Gaps = 16/96 (16%) Frame = -1 Query: 5 KENKKNADYEIFLRDRKLKYEKIRK-------RNALHNKFILPIINFIKGI-------IN 50 K N KN Y D L EK N H F +N+ G N Sbjct: 1122 KHNFKNNSYSQLYEDIFLTIEKFLDISQLKFDNNFTHTNFYNNWLNYNYGSNKNNKEKSN 943 Query: 51 FIKTVINILA--IFFKTLLGQSNTSQSSNGKNNDDD 84 F K+V IFF+TLL + + KNND D Sbjct: 942 FFKSVSMSANNNIFFETLLKKKKEINENCLKNNDYD 835 >Plasmodium_gallinaceum|Pg_2265551.c000413169.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5416 Score = 25.8 bits (55), Expect = 3.4 Identities = 26/68 (38%), Positives = 32/68 (47%), Gaps = 7/68 (10%) Frame = +3 Query: 4 RKENKK-----NADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVI 56 +K+NKK N FL + KY I N NK ++ NFI I FI I Sbjct: 594 KKKNKKDPLTLNVYLL*FLCELN*KY-LISLHNLKINKILIKYF*NNFILFITFFIYL*I 770 Query: 57 NILAIFFK 64 NIL +FFK Sbjct: 771 NILILFFK 794 >Plasmodium_gallinaceum|Pg_2265551.c000012366.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4788 Score = 25.8 bits (55), Expect = 3.4 Identities = 20/79 (25%), Positives = 38/79 (48%) Frame = +3 Query: 2 DDRKENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAI 61 +++KE KNA+ +Y + + N+ +K II+ +K +K +N Sbjct: 4044 EEKKEIIKNAEK---------RYLDLSESNSREDK----IIDALKNYRTELKVELNKKIN 4184 Query: 62 FFKTLLGQSNTSQSSNGKN 80 FK ++ +NTS + G+N Sbjct: 4185 EFKNIMCDNNTSNNKPGEN 4241 >Plasmodium_gallinaceum|Pg_2265551.c000014147.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2198 Score = 25.8 bits (55), Expect = 3.4 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -2 Query: 6 ENKKNAD-YEIFLRDRKLKYEKIRKRNALHNK 36 +NK+N D YE EK+ K+N+ HNK Sbjct: 2020 DNKENLDTYENSSNKNNNSKEKLEKKNSKHNK 1925 >Plasmodium_gallinaceum|Pg_2265551.c000127931.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6501 Score = 25.8 bits (55), Expect = 3.4 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 4 RKENKKNADYEIFLRDRKLKYEKI-RKRNALHNKF 37 +KENK N Y ++ K K KI +K+ +NKF Sbjct: 279 KKENKNNL-YNTVMKQSKKKISKIIKKKKRFYNKF 380 >Plasmodium_gallinaceum|Pg_2265551.c000012251.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4555 Score = 25.8 bits (55), Expect = 3.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 70 SNTSQSSNGKNNDDDD 85 +N + +SN NNDDDD Sbjct: 4214 NNNNNNSNNNNNDDDD 4167 >Plasmodium_gallinaceum|Pg_2265551.c000413080.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3397 Score = 25.8 bits (55), Expect = 3.4 Identities = 22/59 (37%), Positives = 26/59 (44%) Frame = +2 Query: 5 KENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF 63 KE KK D KL Y I+ R L NK+ + II+ K II I IFF Sbjct: 2900 KEKKKEKDK*YI----KLIYV*IK*RYILKNKYRMKIISIYKVIITMICPYYIFSIIFF 3064 >Plasmodium_gallinaceum|Pg_2265551.c000413948.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11091 Score = 25.8 bits (55), Expect = 3.4 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ I FI INIL +FFK L Sbjct: 1024 NFIRFIKFFIYL*INILILFFKEL 1095 Score = 25.8 bits (55), Expect = 3.4 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +3 Query: 26 KIRKRNALHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 K++ N LHN I + N I+ II F + INIL +FFK L Sbjct: 6171 KLKIFNFLHNLKINKTLIKYF*NNIIQFIIFFSYS*INILILFFKDL 6311 >Plasmodium_gallinaceum|Pg_2265551.c000500317.Contig2|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7474 Score = 25.8 bits (55), Expect = 3.4 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -2 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFK 64 LHN I I+ FI+ II FI INIL +FFK Sbjct: 5664 LHNLDISNILIKYF*NKFIRFIIFFIYL*INILILFFK 5551 >Plasmodium_gallinaceum|Pg_Contig16|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11138 Score = 25.8 bits (55), Expect = 3.4 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 51 FIKTVINILAIFFKTLL 67 FIKTV+NI+ IFF +L Sbjct: 9902 FIKTVLNIITIFFIFIL 9952 >Plasmodium_gallinaceum|Pg_2265551.c000413726.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7157 Score = 25.8 bits (55), Expect = 3.4 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ I FI INIL +FFK L Sbjct: 5760 NFIRFIKFFIYL*INILILFFKEL 5689 >Plasmodium_gallinaceum|Pg_Contig80|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7275 Score = 25.8 bits (55), Expect = 3.4 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 10/50 (20%) Frame = -1 Query: 7 NKKNADYEIFLRDRKLK----------YEKIRKRNALHNKFILPIINFIK 46 N N +YEIFL + K K +E+++ L+ K IIN +K Sbjct: 3840 NSDNDNYEIFLNELKEKNLYDKNKIKNFERMKGVGLLYRKLTYEIINELK 3691 >Plasmodium_gallinaceum|Pg_2265551.c000320840.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 15863 Score = 25.8 bits (55), Expect = 3.4 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 35 NKFILPIINFIKGIINFIKTVINILAIFFKTLLGQS---NTSQSS 76 + I+ + F K + N K+VINI +F LLG+ NT SS Sbjct: 13633 SSLIVLSLEFSK*LYNSFKSVINIFKLFKIILLGKQFLFNTFNSS 13767 Score = 24.6 bits (52), Expect = 7.6 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = +1 Query: 9 KNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAI 61 KN Y K+K + R L +I+ I +F+K + +K +INI + Sbjct: 5905 KNISYIKSYVSCKIKIKYSRHSEQLIKYYIINIFSFLKCMYKELKDLINITCL 6063 >Plasmodium_gallinaceum|Pg_2265551.c000127798.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5568 Score = 25.8 bits (55), Expect = 3.4 Identities = 24/97 (24%), Positives = 37/97 (38%), Gaps = 13/97 (13%) Frame = +3 Query: 2 DDRKENKKNADYEIFLRDR-KLKYEKIRKRNALHNKFILPIINFIKGIIN---------- 50 + + EN+K + +I D K KY K KR+ K +I + K N Sbjct: 348 NSKVENEKYENRDIECLDNIKKKYNKKEKRSLDMFKKEHNVIQYEKEKCNEKIEKYLDKD 527 Query: 51 --FIKTVINILAIFFKTLLGQSNTSQSSNGKNNDDDD 85 F V+N+ + N Q NN+DD+ Sbjct: 528 FYFKNDVVNVEQVEINEEKSNENNEQCKKNSNNEDDE 638 >Plasmodium_gallinaceum|Pg_2265551.c000320693.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1716 Score = 25.8 bits (55), Expect = 3.4 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = -1 Query: 9 KNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLLG 68 K IF ++ L +K +K+N K ILP+I+++ + IN + FF +G Sbjct: 582 KGGSLHIFSKNLALGQKKKKKKNRNCLKKILPLISYLDQGVK-----INKIGSFFTPQIG 418 Query: 69 Q 69 + Sbjct: 417 E 415 >Plasmodium_gallinaceum|Pg_2265551.c000129076.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3290 Score = 25.8 bits (55), Expect = 3.4 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 9/70 (12%) Frame = -3 Query: 5 KENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFI---------KTV 55 K K + I + + +K ++ + N L+ FI+P+ N + +IN KT Sbjct: 1260 KGKTKRVCFII*INKKVVKIKRKKV*NVLYILFIIPLSNTLTSVINLFIILPKLLL*KTC 1081 Query: 56 INILAIFFKT 65 I IF T Sbjct: 1080 IGAYKIFINT 1051 >Plasmodium_gallinaceum|Pg_2265551.c000500375.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4292 Score = 25.8 bits (55), Expect = 3.4 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 43 NFIKGIINFIKTVINILAIFF 63 NFI+ II FI INIL +FF Sbjct: 2948 NFIRFIIFFIYL*INILIVFF 2886 >Plasmodium_gallinaceum|Pg_2265551.c000320220.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5864 Score = 25.8 bits (55), Expect = 3.4 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -3 Query: 12 DYEIFLRDRKLKYEKIRKRNALHNK 36 D EI ++ +K K +K RK+N LHNK Sbjct: 4221 DREIQIKKKK-KMKKRRKKNKLHNK 4150 Score = 24.6 bits (52), Expect = 7.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 32 ALHNKFILPIINFIKGIINFIKTVINIL 59 A + KFI+ I F+ IN KT+I IL Sbjct: 5078 AFYRKFIILFIIFMISFINIGKTII*IL 4995 >Plasmodium_gallinaceum|Pg_2265551.c000241797.Contig1|2007-01- 03|ds-DNA|Plasmodium_gallinaceum_Sanger Length = 5909 Score = 25.8 bits (55), Expect = 3.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 71 NTSQSSNGKNNDDDDGFFKKKRTG 94 N QS++ N+D++ FFKK R G Sbjct: 66 NNIQSNDKNMNNDENIFFKKSRIG 137 >Plasmodium_gallinaceum|Pg_2265551.c000128696.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2794 Score = 25.8 bits (55), Expect = 3.4 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 14/64 (21%) Frame = -2 Query: 15 IFLRDRKLKYEKIRKRNALHNKFI---LPII-----------NFIKGIINFIKTVINILA 60 +F++ LKY KI+K+ + LP + NF+ IN + VIN+ Sbjct: 1548 VFIKYIYLKYLKIKKKKKKKYSLLTIFLPFLVNVFFK*SISHNFL*FYINHLFKVINVCR 1369 Query: 61 IFFK 64 I+FK Sbjct: 1368 IYFK 1357 >Plasmodium_gallinaceum|Pg_2265551.c000414738.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2750 Score = 25.8 bits (55), Expect = 3.4 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -1 Query: 19 DRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF 63 ++ + +K +K+N + +I I F+K ++ F K + IL I F Sbjct: 2630 NKLITIKKKKKKNTIF*SYIYSKIYFLKKVLFFDKITLIILKIHF 2496 >Plasmodium_gallinaceum|Pg_2265551.c000413741.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11263 Score = 25.8 bits (55), Expect = 3.4 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -3 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 N I+ II FI + INIL +FFK + Sbjct: 3767 NIIRIIIFFIYS*INILILFFKEI 3696 >Plasmodium_gallinaceum|Pg_2265551.c000413647.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7746 Score = 25.8 bits (55), Expect = 3.4 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 7/69 (10%) Frame = -2 Query: 6 ENKKN-----ADYEIFLRDRKLKYEKIRKRNALHNKFILPII--NFIKGIINFIKTVINI 58 +NKKN ++ FL + KY I N+ NK ++ N I+ II FI INI Sbjct: 7274 KNKKNRLILNVNHL*FLCELN*KY-LIFLHNSKINKILIKYF*NNIIQFIIFFIYL*INI 7098 Query: 59 LAIFFKTLL 67 +FFK L+ Sbjct: 7097 HILFFKELI 7071 Score = 24.3 bits (51), Expect = 10.0 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 6/41 (14%) Frame = -1 Query: 33 LHNKFI--LPII----NFIKGIINFIKTVINILAIFFKTLL 67 LHN I +PI N I+ II FI INI +FFK L+ Sbjct: 471 LHNSKINKIPIKYFQNNIIQFIIFFIYL*INIHILFFKELI 349 >Plasmodium_gallinaceum|Pg_2265551.c000013148.Contig1|2007-01- 03|ds-DNA|Plasmodium_gallinaceum_Sanger Length = 2568 Score = 25.8 bits (55), Expect = 3.4 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 7/45 (15%) Frame = +1 Query: 42 INFIKGIINFIKTVINILAIFFKTLL-------GQSNTSQSSNGK 79 IN+++ ++ KTV + + F++LL G T+ S NGK Sbjct: 7 INWVEKXLSLKKTVTSFPILLFQSLLHTNIFLLGSDETTNSKNGK 141 >Plasmodium_gallinaceum|Pg_2265551.c000413724.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5324 Score = 25.4 bits (54), Expect = 4.5 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = -3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTLL 67 LHN I I+ N I+ II FI INI +FFK L+ Sbjct: 4278 LHNSKINKILIKYFQNNIIQFIIFFIYL*INIHILFFKELI 4156 >Plasmodium_gallinaceum|Pg_2265551.c000128890.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1742 Score = 25.4 bits (54), Expect = 4.5 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = -1 Query: 21 KLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLLGQSNT 72 KL +E I+ L F+L I I +I INI IFF T + Q +T Sbjct: 818 KLNFEIIKNIILLFRSFLLLIST--PNIFLYIVQFINIYKIFFFTFIIQLST 669 >Plasmodium_gallinaceum|Pg_2265551.c000412981.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3115 Score = 25.4 bits (54), Expect = 4.5 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 43 NFIKGIINFIKTVINILAI 61 N I IINF++T+ NIL I Sbjct: 1491 NLIFSIINFLRTIPNILTI 1547 >Plasmodium_gallinaceum|Pg_2265551.c000128188.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3279 Score = 25.4 bits (54), Expect = 4.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 42 INFIKGIINFIKTVINILAIFF 63 +N+IK IINFI + IFF Sbjct: 3091 LNYIKNIINFIIFIFIFFLIFF 3156 >Plasmodium_gallinaceum|Pg_2265551.c000012483.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1952 Score = 25.4 bits (54), Expect = 4.5 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -2 Query: 41 IINFIKGIINFIKTV--INILAIFFKTLL 67 ++NFIK NFI T I I IFF T+L Sbjct: 1216 LVNFIKNDTNFIFTTSYIYIYFIFFFTIL 1130 >Plasmodium_gallinaceum|Pg_2265551.c000318947.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3913 Score = 25.4 bits (54), Expect = 4.5 Identities = 19/81 (23%), Positives = 40/81 (49%), Gaps = 1/81 (1%) Frame = -2 Query: 5 KENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFK 64 KE +K +Y+ ++D + +++ + K+ N + + N + +NI + K Sbjct: 2994 KEERKEEEYKEEIKDEMKEKNDKEEKHEVEKKYRKE--NILGNLNNNVNEYLNINSK--K 2827 Query: 65 TLLG-QSNTSQSSNGKNNDDD 84 + + N++ +S KNNDDD Sbjct: 2826 HFMNCEQNSNYNSYIKNNDDD 2764 >Plasmodium_gallinaceum|Pg_2265551.c000321058.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11414 Score = 25.4 bits (54), Expect = 4.5 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 3/82 (3%) Frame = -3 Query: 5 KENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKT---VINILAI 61 K NKK I RD KY+K + L + +LP+++ I+ F T INI I Sbjct: 3588 KSNKK-----INSRDLMEKYKKCMRLFNLASIILLPVLSMTVSIVAFTSTDQKYINISNI 3424 Query: 62 FFKTLLGQSNTSQSSNGKNNDD 83 L ++ S N D+ Sbjct: 3423 ITSLYLVLNSILLSDLRSNKDN 3358 >Plasmodium_gallinaceum|Pg_2265551.c000319909.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1796 Score = 25.4 bits (54), Expect = 4.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = +1 Query: 29 KRNALH----NKFILPIINFIKGIINFIKTVINILAIFFKTLL 67 KRN L+ F LP+ F K +NFIK + + ++ K L Sbjct: 1120 KRNMLNIWIGKIFYLPLKRFFKISLNFIKNLYFLKGLYSKVFL 1248 >Plasmodium_gallinaceum|Pg_2265551.c000413341.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5961 Score = 25.4 bits (54), Expect = 4.5 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +3 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI II FI INI +FFK L Sbjct: 852 NFILFIIFFIYL*INIFILFFKKL 923 >Plasmodium_gallinaceum|Pg_2265551.c000410341.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 10678 Score = 25.4 bits (54), Expect = 4.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ II FI INI+ +F K L Sbjct: 5817 NFIRFIIFFIYL*INIIILFLKEL 5888 >Plasmodium_gallinaceum|Pg_2265551.c000128146.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7208 Score = 25.4 bits (54), Expect = 4.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 31 NALHNKFILPIINFIKGIINFIKTVIN 57 ++LH KFIL NF NFI+ +N Sbjct: 696 SSLHKKFIL*FYNFTISQFNFIEFSLN 776 >Plasmodium_gallinaceum|Pg_2265551.c000414956.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5332 Score = 25.4 bits (54), Expect = 4.5 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = -3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ FI+ II FI INIL +FF L Sbjct: 3458 LHNLEISKILITYF*NKFIRFIIFFIYL*INILILFFNEL 3339 >Plasmodium_gallinaceum|Pg_2265551.c000242044.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2793 Score = 25.4 bits (54), Expect = 4.5 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +3 Query: 36 KFILPIINFIKGIINFIKT----VINILAIF 62 +F L NF+ GIINF T INIL +F Sbjct: 246 EFYLVNFNFLIGIINFFLTQVYIYINILILF 338 >Plasmodium_gallinaceum|Pg_2265551.c000320782.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5377 Score = 25.4 bits (54), Expect = 4.5 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 15 IFLRDRKLKYEKIRKRNALHNKFILPIINFI----KGIINF 51 IF K+ +EK K +H K+IL I F+ K +NF Sbjct: 1110 IFFDQNKINHEKFYKNQFVHKKYIL-ICYFLRKKKKNFLNF 1229 >Plasmodium_gallinaceum|Pg_2265551.c000012789.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 9240 Score = 25.4 bits (54), Expect = 4.5 Identities = 22/90 (24%), Positives = 38/90 (42%) Frame = -3 Query: 6 ENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKT 65 EN + D+ I + + L I N ++ F+ N K ++I I +L Sbjct: 6094 ENNNSTDFNIDKKHKSLI--DIDHLNQVNKSFLNESNNIFKSDSSYISNDIKLL-----N 5936 Query: 66 LLGQSNTSQSSNGKNNDDDDGFFKKKRTGG 95 + + NT+ ++N N+DDD K G Sbjct: 5935 GIKRLNTNSTNN---NEDDDALIDNKNIKG 5855 >Plasmodium_gallinaceum|Pg_2265551.c000241587.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8598 Score = 25.4 bits (54), Expect = 4.5 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = -2 Query: 9 KNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIIN 50 KN Y+ FLR+ + EKI+K ++ + L IIN++ I+N Sbjct: 3839 KNI*YKFFLRNCLI*NEKIKKYIHIY-IYKLKIINYVGFILN 3717 >Plasmodium_gallinaceum|Pg_2265551.c000013388.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4007 Score = 25.4 bits (54), Expect = 4.5 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 11/54 (20%) Frame = +2 Query: 5 KENKKNADYEIFLRDRKLKYEKIR-----------KRNALHNKFILPIINFIKG 47 K+N + YEIF RD K+KYE+ + K+ + KFI+ ++ +G Sbjct: 1406 KDNLPSQTYEIFERD-KIKYEQYQIAICKYLSDELKKKNNNKKFIIFVVGAGRG 1564 >Plasmodium_gallinaceum|Pg_2265551.c000319664.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6010 Score = 25.4 bits (54), Expect = 4.5 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 3/90 (3%) Frame = +3 Query: 3 DRKENKKNADYE---IFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINIL 59 ++KE+ NA +E + + DR++ + + + N + N IK V N Sbjct: 3915 EKKEDCLNAYFEMDNVIIDDRRIHVDFCQSLSKYKNNYTR----------NAIKNVFN-- 4058 Query: 60 AIFFKTLLGQSNTSQSSNGKNNDDDDGFFK 89 QS+ S+N +NNDD+ FK Sbjct: 4059 ----NDDKKQSDYKNSNNDQNNDDNIRIFK 4136 >Plasmodium_gallinaceum|Pg_2265551.c000413073.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3357 Score = 25.4 bits (54), Expect = 4.5 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 10/74 (13%) Frame = -2 Query: 3 DRKENKKNADYEI----FLRDRKLKYEKIRKRNALHNKFILPIIN------FIKGIINFI 52 ++K KK+ + FL K KY +LHN I+ I FI+ II +I Sbjct: 3326 EKKNKKKHLTLNVYHL*FLYALK*KY-----LISLHNLEIIKNIIKYF*NIFIRFIIFYI 3162 Query: 53 KTVINILAIFFKTL 66 INIL +FFK L Sbjct: 3161 YL*INILILFFKEL 3120 >Plasmodium_gallinaceum|Pg_2265551.c000316536.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 9170 Score = 25.4 bits (54), Expect = 4.5 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = -1 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I I+ FI II FI INIL +FFK L Sbjct: 8408 LHNLEISNILIKYC*NKFILYIIFFIYL*INILILFFKEL 8289 >Plasmodium_gallinaceum|Pg_2265551.c000014158.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5455 Score = 25.4 bits (54), Expect = 4.5 Identities = 10/48 (20%), Positives = 24/48 (50%) Frame = +2 Query: 12 DYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINIL 59 +YE + + + + K + + NKFI + F++ I +I ++ + Sbjct: 545 NYEKLNKSNNIYFLNLYKNSIIKNKFIETTMYFLEYIFTYISDIVTFI 688 >Plasmodium_gallinaceum|Pg_2265551.c000500376.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5346 Score = 25.0 bits (53), Expect = 5.9 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +1 Query: 37 FILPIINFIKGIINFIKTVINILAIFFKTL 66 +++ ++ K ++NFI +IN+L+I K L Sbjct: 2005 YVILVLCLTKVVLNFITDLINVLSISDKLL 2094 >Plasmodium_gallinaceum|Pg_2265551.c000014074.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7061 Score = 25.0 bits (53), Expect = 5.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 33 LHNKFILPIINFIKGIINFIKTVINILAIFFKTLLGQSN 71 L N I+ II IIN I +IN++ I T++ S+ Sbjct: 5251 LQNIIIIVIIVIAVLIINIIILIINMIIIIIITIISSSS 5367 Score = 24.3 bits (51), Expect = 10.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 71 NTSQSSNGKNNDDDD 85 N + ++N NNDDDD Sbjct: 5490 NNNSNNNNNNNDDDD 5446 >Plasmodium_gallinaceum|Pg_2265551.c000015273.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1535 Score = 25.0 bits (53), Expect = 5.9 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 21 KLKYEKIRKRNALHNKFILPI-INFIKGIINFIKTVINILAIFF 63 K ++K +N + NK P+ +NF+KG N K+ L +FF Sbjct: 960 KFFFKKNIYKN*IFNKIKTPMGLNFLKGGENLYKS*FFFLVLFF 829 >Plasmodium_gallinaceum|Pg_2265551.c000320867.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7260 Score = 25.0 bits (53), Expect = 5.9 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 36 KFILPII--NFIKGIINFIKTVINILAIFFKTL 66 KF++ I N I+ II FI NIL +FFK L Sbjct: 522 KFLIKYI*NNIIRFIIFFIYL*NNILILFFKEL 620 >Plasmodium_gallinaceum|Pg_2265551.c000316400.Contig2|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 24245 Score = 25.0 bits (53), Expect = 5.9 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = -1 Query: 4 RKENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVI 56 +K+ KKN + ++ +K I+K+N N + I IK N IK +I Sbjct: 13940 KKKKKKNKNNHQ*IKKIMIKNRNIKKKNIYKNSYFEFTITPIKLQSNDIKFII 13782 >Plasmodium_gallinaceum|Pg_2265551.c000413015.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3117 Score = 25.0 bits (53), Expect = 5.9 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = -3 Query: 33 LHNKFILPII------NFIKGIINFIKTVINILAIFFKTL 66 LHN I II FI II FI INI +FFK L Sbjct: 1957 LHNLKINKIIIKYF*NKFILFIIYFIYL*INIFILFFKEL 1838 >Plasmodium_gallinaceum|Pg_2265551.c000012372.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4313 Score = 25.0 bits (53), Expect = 5.9 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = -1 Query: 20 RKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLLGQS-NTSQSSNG 78 RKLKYEK+ K+ FIL I I+ + KT + + + S N + Sbjct: 3782 RKLKYEKLNKKVT----FIL-----ISSIMTWNKTKRKFIKKKIEEIKNNSGNNEELIEN 3630 Query: 79 KNNDDDDGFFKKKRT 93 KN ++ + ++K T Sbjct: 3629 KNLENKNSLYEKNNT 3585 >Plasmodium_gallinaceum|Pg_2265551.c000240580.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1028 Score = 25.0 bits (53), Expect = 5.9 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -3 Query: 15 IFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF 63 IFL+ K+K K+ K+ + K I+ INF ++K IL+ FF Sbjct: 324 IFLKKYKIKLTKV*KKKKKYLKIIIHRINF---KARYLKI*K*ILSFFF 187 >Plasmodium_gallinaceum|Pg_2265551.c000412545.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11954 Score = 25.0 bits (53), Expect = 5.9 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -2 Query: 56 INILAIFFKTLLGQSNTSQSSNGKNNDDDDGFFKKKRT 93 IN+ I L + + SSN NNDD +K+T Sbjct: 10582 INLTNIHIDYLFKRLTENNSSNNNNNDDSLSVKSEKKT 10469 >Plasmodium_gallinaceum|Pg_2265551.c000012664.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7331 Score = 25.0 bits (53), Expect = 5.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 69 QSNTSQSSNGKNNDDDDGFFKKKRTGGLPKSRIMELKN 106 ++N + SS NND K +T +PK+++ + KN Sbjct: 2002 KANVNFSSASSNNDALSILSKSNKTIRIPKNKLQKQKN 2115 >Plasmodium_gallinaceum|Pg_2265551.c000410432.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 16147 Score = 25.0 bits (53), Expect = 5.9 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 22/78 (28%) Frame = -1 Query: 7 NKKNADYEIFL-----------RDRKLKYEKI--------RKRNALHNKFILPIINFIKG 47 +KK Y+ FL R +K+ ++KI +K+ K + ++NF+KG Sbjct: 10090 HKKKKIYQFFLFVFL*KKIKTVRKKKINWKKICYQ*IKKKKKKKFFFEKRRMILMNFVKG 9911 Query: 48 IINFIKT---VINILAIF 62 I I INI IF Sbjct: 9910 IFVHITIKFHAINIYIIF 9857 >Plasmodium_gallinaceum|Pg_2265551.c000318869.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3055 Score = 25.0 bits (53), Expect = 5.9 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 5/52 (9%) Frame = -2 Query: 15 IFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINF-----IKTVINILAI 61 IFL + L E ++ L KF++ + FIK II F IK +I I+ I Sbjct: 1974 IFLEKKHL-LEALKYYYILQKKFVIAFLMFIKNIIWF*KI*RIKILIIIIII 1822 >Plasmodium_gallinaceum|Pg_2265551.c000130089.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1696 Score = 25.0 bits (53), Expect = 5.9 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = -3 Query: 34 HNKF-----ILPIINFIKGIINFIKTVINILAIFFKT 65 +NKF I IINF + +F I +FFKT Sbjct: 704 YNKFFYELLIFLIINFSSSVFDFFMFKIKFCILFFKT 594 >Plasmodium_gallinaceum|Pg_2265551.c000128488.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4559 Score = 24.6 bits (52), Expect = 7.6 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = +2 Query: 5 KENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF- 63 K+ +N + I + LK + +K N K + F K +I+ K NI+ ++ Sbjct: 1193 KDELENLNILIIYDEWSLKEDLKKKANEAGYK-----VYFYKDLIDNYKNK-NIIPQYYH 1354 Query: 64 --KTLLGQSNTSQSSNGKNNDDDD 85 KT N + SSN KNN DD+ Sbjct: 1355 YDKTFSNGHNRN-SSNEKNNSDDN 1423 >Plasmodium_gallinaceum|Pg_2265551.c000127893.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1873 Score = 24.6 bits (52), Expect = 7.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 31 NALHNKFILPIINFIKGIINFIKTVINILAIFFKTLL 67 N N F++ +NFI G+ N + V+ F+K LL Sbjct: 1603 NYCKNVFLI-YVNFIYGLYNIMFIVLEGFVYFYKKLL 1710 >Plasmodium_gallinaceum|Pg_2265551.c000239613.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1827 Score = 24.6 bits (52), Expect = 7.6 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = -1 Query: 4 RKENKKNADYEIFLRDRKLKY---EKIRKRNALHNKFILPIINFIKGIINFIK 53 +K+ KKN Y F+ + +KY I+K+ H +IL NFI I F K Sbjct: 504 KKKKKKNEIYV*FINIKLIKYI*IR*IKKKK*FHISWIL---NFILQIFIFKK 355 >Plasmodium_gallinaceum|Pg_2265551.c000129163.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3460 Score = 24.6 bits (52), Expect = 7.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -2 Query: 4 RKENKKNADYEIFLRDRK 21 +K+ KK DYE F +D+K Sbjct: 2499 KKDKKKKDDYENFYKDKK 2446 >Plasmodium_gallinaceum|Pg_2265551.c000413416.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8528 Score = 24.6 bits (52), Expect = 7.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 41 IINFIKGIINFIKTVINILAIFFKTLL 67 I FIK I +FI VIN + + F ++ Sbjct: 1640 ISKFIKNIFHFISIVINNIRLIFINII 1560 >Plasmodium_gallinaceum|Pg_2265551.c000241671.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2053 Score = 24.6 bits (52), Expect = 7.6 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 69 QSNTSQSSNGKNNDDDDGFFKKKRTGGLPKSRIMELKNL 107 + N + N K+ND+D+ + K L ++ LKNL Sbjct: 745 EENKYEKGNEKDNDNDNYYIKDSLNKILESNKDSYLKNL 861 >Plasmodium_gallinaceum|Pg_2265551.c000321075.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5260 Score = 24.6 bits (52), Expect = 7.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 41 IINFIKGIINFIKTVINILAIFFKTL 66 I N + NFIK +INIL F TL Sbjct: 227 IYNITIKVYNFIK*IINILLYFI*TL 150 >Plasmodium_gallinaceum|Pg_2265551.c000411928.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3200 Score = 24.6 bits (52), Expect = 7.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 7 NKKNADYEIFLRDRKLKYEKIRKRNALHNKF 37 NK N + + FLR K I KRN+ +NK+ Sbjct: 965 NKSNNNCKCFLRKNK-----IHKRNSRYNKY 888 >Plasmodium_gallinaceum|Pg_Contig12|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6817 Score = 24.6 bits (52), Expect = 7.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -3 Query: 32 ALHNKFILPI-INFIKGIINFIKTVINILAIFFKTLL 67 A H ++ I + F INFIK + NI FFK ++ Sbjct: 1412 AKHKRYFFIIHLKFFF*SINFIKELRNICIYFFKIII 1302 >Plasmodium_gallinaceum|Pg_2265551.c000014108.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7122 Score = 24.6 bits (52), Expect = 7.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 4 RKENKKNADYEIFLRDRKLKYEKIRKRN 31 + E+ N Y L D YEK RK+N Sbjct: 990 KNEHNNNKSYSNKLNDSDSSYEKRRKKN 1073 >Plasmodium_gallinaceum|Pg_2265551.c000013870.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5333 Score = 24.6 bits (52), Expect = 7.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 70 SNTSQSSNGKNNDDDD 85 +N + ++N NNDDDD Sbjct: 4496 NNNNNNNNNNNNDDDD 4449 Score = 24.6 bits (52), Expect = 7.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 70 SNTSQSSNGKNNDDDD 85 +N + ++N NNDDDD Sbjct: 4430 NNNNNNNNNNNNDDDD 4383 >Plasmodium_gallinaceum|Pg_2265551.c000012333.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3260 Score = 24.6 bits (52), Expect = 7.6 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +2 Query: 2 DDRKENKKNADYEIFLRDRKLKYEKIRKRN 31 D+ K NK +++ + ++ K+KY+ K+N Sbjct: 2282 DEIKNNKNSSNINVIEKNDKVKYDNDDKKN 2371 >Plasmodium_gallinaceum|Pg_2265551.c000128432.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4602 Score = 24.6 bits (52), Expect = 7.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 34 HNKFILPIINFIKGIINFIKTVIN 57 HN +PI NFI GI N T+ N Sbjct: 3003 HNFHHIPINNFIGGINNMNNTINN 2932 >Plasmodium_gallinaceum|Pg_2265551.c000410427.Contig3|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 18257 Score = 24.6 bits (52), Expect = 7.6 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -1 Query: 1 MDDRKENKKNADYEIFLRDRKLKYEKIRKRNALHNKFIL 39 +D+RKEN KN EI + + K+N K IL Sbjct: 11027 LDERKENLKNLSKEII--QSSINNSNLNKKNKEKLKIIL 10917 >Plasmodium_gallinaceum|Pg_2265551.c000013818.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3943 Score = 24.6 bits (52), Expect = 7.6 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = -2 Query: 19 DRKLKYEKIRKRNALHNKFILPIINFIKGIIN-FIKTVINILAIFF 63 +++ K +K +K+N HN F+L F + N +I T I IL ++F Sbjct: 183 NKQFKKKKEKKKNIYHNIFLLFNK*FS**LDNKYICTYIRILVLYF 46 >Plasmodium_gallinaceum|Pg_2265551.c000410221.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 18543 Score = 24.6 bits (52), Expect = 7.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 33 LHNKFILPIINFIKGIINFIKTVINILAIFFKTL 66 L K +P+IN +KG I F+ ++ I FF + Sbjct: 17077 LKKKLFIPLINILKG*I-FLTFLLYIFFFFFNNI 17175 >Plasmodium_gallinaceum|Pg_2265551.c000128194.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1672 Score = 24.6 bits (52), Expect = 7.6 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = -2 Query: 41 IINFIKGIINFIKTVINILA 60 +INFI I+NFIKT+ IL+ Sbjct: 1344 LINFI*LILNFIKTLF*ILS 1285 >Plasmodium_gallinaceum|Pg_2265551.c000319493.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5714 Score = 24.6 bits (52), Expect = 7.6 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 27 IRKRNALHNKFILPIINFIKGIINFIKTVINILAI 61 I K + + KFI P+IN+IK I+ IK V I+ I Sbjct: 1009 ILKTSKKNIKFI-PLINYIKIIVRKIKHVNYIIGI 1110 >Plasmodium_gallinaceum|Pg_2265551.c000320421.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3156 Score = 24.6 bits (52), Expect = 7.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -2 Query: 3 DRKENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILP 40 ++K+NK N E+ Y K + +N + FI+P Sbjct: 734 EKKQNKNNNYEELINTYTSSDYLKYKNKNMFNGYFIIP 621 >Plasmodium_gallinaceum|Pg_2265551.c000320187.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 18903 Score = 24.6 bits (52), Expect = 7.6 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 5/63 (7%) Frame = -2 Query: 6 ENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFI-----KGIINFIKTVINILA 60 E KK + IF+ K K +K + NA +F + N+ K IIN IK +INI Sbjct: 15740 EEKKLINI*IFILI*KKKKKKKKIMNA*--EFFCLVFNYNWYKI*KKIINSIKKLINI*N 15567 Query: 61 IFF 63 +FF Sbjct: 15566 LFF 15558 >Plasmodium_gallinaceum|Pg_2265551.c000012687.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8585 Score = 24.6 bits (52), Expect = 7.6 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -2 Query: 22 LKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF 63 LKY KI K F+ + NF K NF+ + FF Sbjct: 5404 LKYRKIFKLIYSF*HFLCSLKNFFKNFYNFV*DFKKVFFFFF 5279 >Plasmodium_gallinaceum|Pg_2265551.c000320431.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 11304 Score = 24.6 bits (52), Expect = 7.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -1 Query: 70 SNTSQSSNGKNNDDDD 85 +N + ++N NNDDDD Sbjct: 8295 NNNNNNNNNNNNDDDD 8248 >Plasmodium_gallinaceum|Pg_2265551.c000013130.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3362 Score = 24.6 bits (52), Expect = 7.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 Query: 23 KYEKIRKRNALHNKF 37 KYEKI+KR + H K+ Sbjct: 2959 KYEKIKKRKSPHKKY 3003 >Plasmodium_gallinaceum|Pg_2265551.c000240895.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1182 Score = 24.6 bits (52), Expect = 7.6 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 4 RKENKKNADYEIFLRDRKLKYEKIRKRNALH 34 +K+ KKN +YE+F+ K +K +K+ L+ Sbjct: 109 KKQAKKNQNYELFI*FN*KKKKKKKKKKTLN 201 >Plasmodium_gallinaceum|Pg_2265551.c000412072.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6733 Score = 24.6 bits (52), Expect = 7.6 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 29 KRNALHNKFILPIINFIKGIINFI 52 K N+ +N +IL IIN ++ NFI Sbjct: 1465 KENSFYNNYILLIINIMEIF*NFI 1536 >Plasmodium_gallinaceum|Pg_2265551.c000413429.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6473 Score = 24.3 bits (51), Expect = 10.0 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 NFI+ II F INIL + FK L Sbjct: 466 NFIRFIIFFTYL*INILILLFKKL 537 >Plasmodium_gallinaceum|Pg_2265551.c000321096.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 17431 Score = 24.3 bits (51), Expect = 10.0 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +1 Query: 49 INFIKTVINILAIFFKTLLGQSNTSQSSNGKNNDDDDGFF 88 IN IKT IL I T LG NTS ++G GFF Sbjct: 10039 INGIKTT-PILEII-TTTLGDINTSPGNDGSTTTACSGFF 10152 >Plasmodium_gallinaceum|Pg_2265551.c000241617.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3380 Score = 24.3 bits (51), Expect = 10.0 Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +2 Query: 23 KYEKIRKRNALHNKFILPIINFIKGIINFIK-TVINILAIFFKTL 66 K++KI+K+N L+ K +PI + FIK T +IL + FK L Sbjct: 269 KFKKIQKKNLLN*KP*IPIFSI------FIKVTKFHILIMDFKYL 385 >Plasmodium_gallinaceum|Pg_2265551.c000130157.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1007 Score = 24.3 bits (51), Expect = 10.0 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 21 KLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIF 62 K K +K +K+N + FIL I++IK + F ++I F Sbjct: 488 KTKQKKKKKKNEIK*SFILNHIDYIKLLKIF*NRTLSIYYFF 613 >Plasmodium_gallinaceum|Pg_2265551.c000412008.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7317 Score = 24.3 bits (51), Expect = 10.0 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 24 YEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFF 63 Y K K ++ FI ++++I +IN + INI IFF Sbjct: 5793 YNK*NK*RNVYILFI*LVVDYIISLIN*LINQINITYIFF 5912 >Plasmodium_gallinaceum|Pg_2265551.c000242051.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3535 Score = 24.3 bits (51), Expect = 10.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 38 ILPIINFIKGIINFIKTVINILAIFF 63 ++ I +FIK I NFI + IL +FF Sbjct: 2131 VVLITSFIKIIENFIIILFEILPLFF 2054 >Plasmodium_gallinaceum|Pg_2265551.c000013489.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6726 Score = 24.3 bits (51), Expect = 10.0 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -1 Query: 43 NFIKGIINFIKTVINILAIFFKTLLGQSNTSQSSNGKNNDD 83 NF+ ++ T+ +F +T + N ++ N NDD Sbjct: 4224 NFVSNEKDYFNTINKSNKLFNETKSNEKNEEKTMNNNKNDD 4102 >Plasmodium_gallinaceum|Pg_2265551.c000129407.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4592 Score = 24.3 bits (51), Expect = 10.0 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +3 Query: 36 KFILPIINFIKGIINFIKTVINILAIFFKTLLGQSNTS 73 KFI+ I+NF + + T+ N+ I L+ N++ Sbjct: 744 KFIVNILNFNENTYSIFATIENLKGIMIIPLIKNENSA 857 >Plasmodium_gallinaceum|Pg_2265551.c000013244.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4277 Score = 24.3 bits (51), Expect = 10.0 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -3 Query: 24 YEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKT 65 Y+KIR ++N F PI+N IN K I L F T Sbjct: 663 YKKIRLYIQINNSFFFPILN--NFYINIFKW*ILKLLYFINT 544 >Plasmodium_gallinaceum|Pg_2265551.c000411869.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 12258 Score = 24.3 bits (51), Expect = 10.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 31 NALHNKFILPIINFIKGIINFIKTVINILAIFFKTLL 67 N LH ++ I F K I + KT+ + +F KTLL Sbjct: 11337 NFLHTILMIFIKKFTK*CIIY*KTISFFIILFTKTLL 11227 >Plasmodium_gallinaceum|Pg_2265551.c000413308.Contig1.3|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5408 Score = 24.3 bits (51), Expect = 10.0 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = -2 Query: 6 ENKKNADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVI 56 + KKN + FL K K +K + R + I+ ++NF+K NFI I Sbjct: 2947 KKKKNQLEKYFLPINKKKIKKKKNRIFILGNEIVFVMNFVKE--NFIHITI 2801 >Plasmodium_gallinaceum|Pg_2265551.c000410381.Contig2|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 17368 Score = 24.3 bits (51), Expect = 10.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 5 KENKKNADYEIFLRDRKLKYEKIRKR 30 ++NK+ E F+R +K Y + KR Sbjct: 1084 RKNKRRKKLEFFIRKKKRGYRNMEKR 1161 >Plasmodium_gallinaceum|Pg_2265551.c000413404.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 5188 Score = 24.3 bits (51), Expect = 10.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 4 RKENKKNADYEIFLRDRKLKYEKIRKRNALHNKF 37 +K+ K N +YE + KLK E I + K+ Sbjct: 3274 KKKTKSNRNYEKLMEKLKLKRENIELKEQNFEKY 3173 >Plasmodium_gallinaceum|Pg_2265551.c000318769.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2238 Score = 24.3 bits (51), Expect = 10.0 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -3 Query: 41 IINFIKGIINFIKTVINILAIFF 63 ++N+IKG F+ +NIL ++F Sbjct: 2041 VLNYIKGYSFFLYDWVNILNLYF 1973 >Plasmodium_gallinaceum|Pg_2265551.c000129228.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3115 Score = 24.3 bits (51), Expect = 10.0 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 7/75 (9%) Frame = +2 Query: 15 IFLRDRKLKYEKIRKRNALHNKFILPII----NFIKGIINFIKTVINILAIF---FKTLL 67 +F + EK+ R L + I NF+KG+ N IK +L F K ++ Sbjct: 782 VFFENSIYMLEKLENRPPLMEELIYAYNYDKENFLKGLENKIKLSQKLLIYFIPLIKNIV 961 Query: 68 GQSNTSQSSNGKNND 82 ++ + SSN D Sbjct: 962 RKAEANFSSNLSEED 1006 >Plasmodium_gallinaceum|Pg_2265551.c000413573.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 12936 Score = 24.3 bits (51), Expect = 10.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 43 NFIKGIINFIKTVINILAIFFKTL 66 N I +I FI +INIL +FF L Sbjct: 9014 NIIGFVIFFIYLLINILILFFNEL 9085 >Plasmodium_gallinaceum|Pg_2265551.c000013861.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8502 Score = 24.3 bits (51), Expect = 10.0 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 43 NFIKGIINFIKTV 55 NF+K IIN++KTV Sbjct: 4901 NFLKKIINYVKTV 4863 >Plasmodium_gallinaceum|Pg_Contig78|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 21495 Score = 24.3 bits (51), Expect = 10.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 70 SNTSQSSNGKNNDDDD 85 +N + ++N NNDDDD Sbjct: 21427 NNNNNNNNNDNNDDDD 21380 >Plasmodium_gallinaceum|Pg_Contig90|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4215 Score = 24.3 bits (51), Expect = 10.0 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -2 Query: 38 ILPIINFIKGIINFIKTVINILAIFFKTLL 67 +LP + +K I+NF K +I + FF+TLL Sbjct: 3545 LLPFSSKLK-ILNFSKLFSSIFSSFFETLL 3459 >Plasmodium_gallinaceum|Pg_2265551.c000130115.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 1859 Score = 24.3 bits (51), Expect = 10.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 11 ADYEIFLRDRKLKYEKIRKRNALHNKFI 38 AD + + R L I+K+N +H KFI Sbjct: 783 ADVFLVVNLRDLSKANIKKKNKVHKKFI 700 >Plasmodium_gallinaceum|Pg_2265551.c000415362.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2802 Score = 24.3 bits (51), Expect = 10.0 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 41 IINFIKGIINFIKTVIN 57 I FIK I +FI TVIN Sbjct: 573 ISKFIKNIFHFISTVIN 623 >Plasmodium_gallinaceum|Pg_2265551.c000413114.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4086 Score = 24.3 bits (51), Expect = 10.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 41 IINFIKGIINFIKTVINILAI 61 II F+K I +FI VIN + I Sbjct: 3019 IIKFLKNIFHFIPIVINDITI 3081 >Plasmodium_gallinaceum|Pg_2265551.c000319834.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 2149 Score = 24.3 bits (51), Expect = 10.0 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 37 FILPIINFIKGIINFIKTVINILAIFFKTLLG 68 F L +I F N + INI IF+ TLLG Sbjct: 1938 FELLLILFFINYRNPLNVYINIAIIFYLTLLG 1843 >Plasmodium_gallinaceum|Pg_2265551.c000413440.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 8883 Score = 24.3 bits (51), Expect = 10.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -1 Query: 4 RKENKKNADYEIFLRDRKLKYEKIRKRNALHNKFI 38 +K+NKKN DY+ + +K+K I R ++ K + Sbjct: 3120 KKKNKKNQDYK---KPKKMKMMAIMLRKSMIMKIL 3025 >Plasmodium_gallinaceum|Pg_2265551.c000013057.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6342 Score = 24.3 bits (51), Expect = 10.0 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 20 RKLKYEKIRKRNALHNKFILPIINFIK 46 +K K EKI + ++NKF+L I ++ Sbjct: 373 KKKKNEKISNQLKIYNKFLLQYIKLLR 453 >Plasmodium_gallinaceum|Pg_2265551.c000128070.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4329 Score = 24.3 bits (51), Expect = 10.0 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 33 LHNKFILPIINFIKGIINFI 52 +H KFIL +I FIK I FI Sbjct: 1204 IHVKFILLMIIFIKSIYYFI 1263 >Plasmodium_gallinaceum|Pg_2265551.c000128862.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 6144 Score = 24.3 bits (51), Expect = 10.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -3 Query: 21 KLKYEKIRKRNALHNKFILPIINFIK--GIINFIKTVINILAIF 62 K K +K +K+N H + INF+ INF NIL+I+ Sbjct: 2020 KNKVKKKKKKNLFHKTILFK*INFLL*FSYINF-----NILSIY 1904 >Plasmodium_gallinaceum|Pg_2265551.c000413651.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 3302 Score = 24.3 bits (51), Expect = 10.0 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 6/41 (14%) Frame = -2 Query: 33 LHNKFI--LPII----NFIKGIINFIKTVINILAIFFKTLL 67 LHN I +PI N I+ II FI INI +FFK L+ Sbjct: 1996 LHNSKINKIPIKYFQNNIIQFIIFFIYL*INIHILFFKELI 1874 >Plasmodium_gallinaceum|Pg_2265551.c000013931.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4145 Score = 24.3 bits (51), Expect = 10.0 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = +2 Query: 20 RKLKYEKIRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLL 67 +K+ + I K LH F + +IK ++ + +INI FFK ++ Sbjct: 2285 QKVFFNSI*KHIYLHTYFY*KYL-YIKFLLIVLNYLINIFVFFFKNII 2425 >Plasmodium_gallinaceum|Pg_2265551.c000413522.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 7836 Score = 24.3 bits (51), Expect = 10.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 45 IKGIINFIKTVINILAIFFKTLLG 68 IK I+NF T++ I I LLG Sbjct: 2592 IKRIVNFFLTLVKIFQIIIYILLG 2663 >Plasmodium_gallinaceum|Pg_2265551.c000012621.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4045 Score = 24.3 bits (51), Expect = 10.0 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +2 Query: 44 FIKGIINFIKTVINILAIFFKTLLGQSNTSQSSNGKNNDDDDGFFKKKRT 93 + KGI+ K INI F + +NT + GKN + KR+ Sbjct: 3179 YTKGILT--KNKINIFYNFGTIIKNNTNTKEKGRGKNEREYGAHSLDKRS 3322 >Plasmodium_gallinaceum|Pg_2265551.c000241942.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 4948 Score = 24.3 bits (51), Expect = 10.0 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 41 IINFIKGIINFIKTVINILAIFF 63 I+NFI NFIKT I I A F Sbjct: 479 ILNFITFCYNFIKTFIFIEAFTF 547 >Plasmodium_gallinaceum|Pg_2265551.c000320359.Contig1|2007-01-03|ds- DNA|Plasmodium_gallinaceum_Sanger Length = 9166 Score = 24.3 bits (51), Expect = 10.0 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -2 Query: 36 KFILPIINFIKGIINFIKTVINILAIFF 63 KF II I IINFIK ++ IFF Sbjct: 7665 KFFRTIICIIVIIINFIK*FYILIVIFF 7582 Database: genome.fa Posted date: Feb 10, 2010 10:01 AM Number of letters in database: 16,926,281 Number of sequences in database: 4347 Lambda K H 0.320 0.140 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,547,327 Number of Sequences: 4347 Number of extensions: 89079 Number of successful extensions: 1240 Number of sequences better than 10.0: 200 Number of HSP's better than 10.0 without gapping: 1123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1236 length of query: 116 length of database: 5,642,093 effective HSP length: 82 effective length of query: 34 effective length of database: 5,285,639 effective search space: 179711726 effective search space used: 179711726 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)