TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= sel1 selenoprotein1 [Plasmodium falciparum 3D7]; partially from XP_001348206.1 # QUERY (116 letters) Database: genome.fa 5578 sequences; 78,051,097 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQY01000307.1| Phytophthora sojae strain P6497 Psojae_Cont30... 29 1.4 gb|AAQY01000835.1| Phytophthora sojae strain P6497 Psojae_Cont83... 27 7.1 >gb|AAQY01000307.1| Phytophthora sojae strain P6497 Psojae_Cont307, whole genome shotgun sequence Length = 66150 Score = 28.9 bits (63), Expect = 1.4 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 66 LLGQSNTSQSSNGKNNDDDD 85 LLG +NT ++NG+N DDD Sbjct: 25458 LLGTNNTKTATNGRNRHDDD 25517 >gb|AAQY01000835.1| Phytophthora sojae strain P6497 Psojae_Cont835, whole genome shotgun sequence Length = 117969 Score = 26.6 bits (57), Expect = 7.1 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +2 Query: 27 IRKRNALHNKFILPIINFIKGIINFIKTVINILAIFFKTLLGQSNTSQSSNGK 79 IR+ N L +K P+ N +KG N + F+TL G ++ QSS GK Sbjct: 101582 IRRSNELDDK--APLFNNVKGAKNGL----------FRTLGGPNSHRQSSKGK 101704 Database: genome.fa Posted date: Jan 19, 2010 5:09 PM Number of letters in database: 78,051,097 Number of sequences in database: 5578 Lambda K H 0.320 0.140 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,709,239 Number of Sequences: 5578 Number of extensions: 61287 Number of successful extensions: 327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 236 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 70 Number of HSP's gapped (non-prelim): 278 length of query: 116 length of database: 26,017,032 effective HSP length: 91 effective length of query: 25 effective length of database: 25,509,434 effective search space: 637735850 effective search space used: 637735850 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (26.2 bits)