TBLASTN 2.2.13 [Nov-27-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= sel1 selenoprotein1 [Plasmodium falciparum 3D7]; partially from XP_001348206.1 # QUERY (116 letters) Database: genome.fa 13 sequences; 8,173,701 total letters Searching.............done Score E Sequences producing significant alignments: (bits) Value gb|AAXT01000004.1| Babesia bovis strain T2Bo chromosome 4 gconti... 26 1.5 gb|AAXT01000003.1| Babesia bovis strain T2Bo chromosome 2 gconti... 25 3.4 gb|AAXT01000001.1| Babesia bovis strain T2Bo chromosome 3 gconti... 25 4.4 >gb|AAXT01000004.1| Babesia bovis strain T2Bo chromosome 4 gcontig_1104837696380, whole genome shotgun sequence Length = 827912 Score = 26.2 bits (56), Expect = 1.5 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = -3 Query: 39 LPIINFIKGIINFIKT--VINILAIFFKTLL 67 LP ++ IKG I+FIKT V N + +F L+ Sbjct: 321384 LPRVSLIKGTISFIKTPSVWNGIGLFISRLI 321292 >gb|AAXT01000003.1| Babesia bovis strain T2Bo chromosome 2 gcontig_1104837696614, whole genome shotgun sequence Length = 1729419 Score = 25.0 bits (53), Expect = 3.4 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -1 Query: 10 NADYEIFLRDRKLKYEKIRKRNALHNKFILPIINFIKGIINFI 52 + D + +RD L YE++R R A + + + I I+ IIN + Sbjct: 825576 DCDNSVVIRD--LLYEQMRPRAASNRYYNVQIFIHIRSIINLL 825454 >gb|AAXT01000001.1| Babesia bovis strain T2Bo chromosome 3 gcontig_1104837696278, whole genome shotgun sequence Length = 2593320 Score = 24.6 bits (52), Expect = 4.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 65 TLLGQSNTSQSSNGKNNDDDDGF 87 TL S S +SNGKN DDG+ Sbjct: 2485314 TLADLSALSIASNGKNPSRDDGY 2485382 Database: genome.fa Posted date: Jan 19, 2010 5:04 PM Number of letters in database: 8,173,701 Number of sequences in database: 13 Lambda K H 0.320 0.140 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 803,581 Number of Sequences: 13 Number of extensions: 8667 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 40 Number of HSP's gapped (non-prelim): 9 length of query: 116 length of database: 2,724,567 effective HSP length: 78 effective length of query: 38 effective length of database: 2,723,553 effective search space: 103495014 effective search space used: 103495014 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)